Search bot image
Loading

AMH antibody | 5/6

100% Secure
Anti Human AMH Antibody, clone 5/6 thumbnail image 1 Anti Human AMH Antibody, clone 5/6 thumbnail image 2 Anti Human AMH Antibody, clone 5/6 thumbnail image 3
Anti Human AMH Antibody, clone 5/6 gallery image 1
Formalin fixed, paraffin embedded ovarian tissue section from a 25 day old mouse stained with Mouse anti Human anti Müllarian Hormone antibody, clone 5/6 (MCA2246).
Anti Human AMH Antibody, clone 5/6 gallery image 2
Published customer image:
Mouse anti Human AMH antibody, clone 5/6 used to demonstrate mouse ovarian granulosa cells expressing anti Müllerian Hormone by immunohistochemistry on formalin fixed, paraffin embedded tissue secteions
Image caption:
Marker studies of Kit-deficient oocytes are consistent with specific defect in oocyte reawakening via Foxo3. (A) Immunohistochemistry for markers as shown at 6 weeks of age; slides counterstained with hematoxylin. Note absence of P-AKT (in contrast to D818V mutant) and constitutively nuclear localization of Foxo3. Scale bars = 25 μm; all panels at same magnification. (B) Immunofluorescence detection of Foxo3 protein; slides counterstained with DAPI. Foxo3 undergoes nuclear to cytoplasmic export in wild-type primary follicles but is constitutively nuclear in the mutant. Scale bar = 10 μm, same for all panels. (C) Analysis of granulosa cells in wild-type and VC; KitL/- ovaries. Immunohistochemistry for markers as shown at 6 wks of age; slides counterstained with hematoxylin. Scale bars = 200 μm in large panels, or 25 μm in small panels; all small panels at same magnification. (D) Absence of Gata1-positive cells in aberrant follicles in VC; KitL/- ovaries. Wild-type testis is shown as a positive control (Gata1 is expressed in Sertoli cells). Scale bar = 25 μm; both panels at same magnification.

From: Saatcioglu HD, Cuevas I, Castrillon DH (2016),br.Control of Oocyte Reawakening by Kit.
PLoS Genet 12(8): e1006215.
Anti Human AMH Antibody, clone 5/6 gallery image 3
Published customer image:
Mouse anti Human AMH antibody, clone 5/6 used to demonstrate mouse ovarian granulosa cells expressing anti Müllerian Hormone by immunohistochemistry on formalin fixed, paraffin embedded tissue secteions
Image caption:
Loss of the primordial follicle pool due to oocyte reawakening.
(A) Oocyte reawakening phenotype at PD7 and PD28. Immunohistochemistry for markers as shown; slides counterstained with hematoxylin. White arrows indicate follicles with atretic (Sall4-negative) oocytes; black arrows indicate AMH-negative granulosa cells. Scale bar = 25 μm; all panels at same magnification. (B) Serum FSH and LH levels of VC; KitD818V(L)/+ and control females at five months of age. *p<0.05, **p<0.01; unpaired student t test; n = 3 animals per genotype. (C) Toluidine-blue stained sections of plastic-embedded ovaries from experimental and sibling controls at 6 weeks of age; scale bar = 10 μm, both panels at same magnification. The follicle shown on the right does not contain a viable oocyte.

From: Saatcioglu HD, Cuevas I, Castrillon DH (2016),br.Control of Oocyte Reawakening by Kit.
PLoS Genet 12(8): e1006215.

Mouse anti Human AMH

Product Type
Monoclonal Antibody
Clone
5/6
Isotype
IgG1
Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
MCA2246T P* 0.1 ml
MCA2246 P* WB 1 ml
Mouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.

AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric ~140 kDa disulphide linked precursor that is cleaved to release the mature ~30 kDa homodimer.

Product Details

Target Species
Human
Species Cross-Reactivity
Target SpeciesCross Reactivity
Mouse
Sheep
Squirrel monkey
Baboon
N.B. Antibody reactivity and working conditions may vary between species.
Product Form
Concentrated Tissue Culture Supernatant - liquid
Preservative Stabilisers
0.1%Sodium Azide
Immunogen
Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Fusion Partners
Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma cell line.

Storage Information

Storage
Store at +4oC or at -20oC if preferred.

This product should be stored undiluted.

Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life
18 months from date of despatch

More Information

UniProt
P03971 Related reagents
Entrez Gene
AMH Related reagents
GO Terms
GO:0001880 Mullerian duct regression
GO:0005179 hormone activity
GO:0005615 extracellular space
GO:0007267 cell-cell signaling
GO:0007506 gonadal mesoderm development
GO:0007530 sex determination
GO:0008083 growth factor activity
GO:0030154 cell differentiation
Regulatory
For research purposes only

Applications of AMH antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Immunohistology - Paraffin 1 1/20 1/40
Western Blotting
  1. 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Histology Positive Control Tissue
Ovary
Copyright © 2018 Bio-Rad Antibodies (formerly AbD Serotec)

Secondary Antibodies Available

Description Product Code Pack Size Applications List Price Quantity
Human anti Mouse IgG1:HRP HCA036P 0.1 mg E
Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed) STAR117A 0.5 mg E WB
Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed) STAR117D488GA 0.1 mg F IF
Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed) STAR117D549GA 0.1 mg F IF WB
Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed) STAR117D649GA 0.1 mg F IF
Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed) STAR117D680GA 0.1 mg F WB
Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed) STAR117D800GA 0.1 mg F IF WB
Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed) STAR117F 0.5 mg F
Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed) STAR117P 0.5 mg E WB
Goat anti Mouse IgG (Fc):FITC STAR120F 1 mg C F
Goat anti Mouse IgG (Fc):HRP STAR120P 1 mg E WB
Rabbit F(ab')2 anti Mouse IgG:RPE STAR12A 1 ml F
Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed) STAR13B 1 mg C E P RE WB
Goat anti Mouse IgG:FITC (Rat Adsorbed) STAR70 0.5 mg F
Goat anti Mouse IgG:RPE (Rat Adsorbed) STAR76 1 ml F
Goat anti Mouse IgG:HRP (Rat Adsorbed) STAR77 0.5 mg C E P
Goat anti Mouse IgG/A/M:Alk. Phos. STAR87A 1 mg C E WB
Goat anti Mouse IgG/A/M:HRP (Human Adsorbed) STAR87P 1 mg E
Rabbit F(ab')2 anti Mouse IgG:Dylight®800 STAR8D800GA 0.1 mg F IF WB
Rabbit F(ab')2 anti Mouse IgG:FITC STAR9B 1 mg F

Application Based External Images

Immunohistology - Paraffin

Product Specific References

References for AMH antibody

  1. Van Saen, D. et al. (2010) Meiotic activity in orthotopic xenografts derived from human postpubertal testicular tissue.
    Hum Reprod. 26: 282-93.
  2. Gruijters, M.J et al. (2003) Anti-Müllerian hormone and its role in ovarian function.
    Mol Cell Endocrinol. 211 (1-2): 85-90.
  3. Weenen, C. et al. (2004) Anti-Mullerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle recruitment.
    Mol Hum Reprod10: 77-83.
  4. Papanastasopoulos, P. et al. (2009) A case of complete androgen insensitivity syndrome presenting with incarcerated inguinal hernia: an immunohistochemical study.
    Fertil Steril. 92: 1169.e11-4.
  5. Campbell, B.K. (2009) The endocrine and local control of ovarian follicle development in the ewe
    Anim. Reprod. 6:159-71
  6. Walker, M.L. et al. (2009) Ovarian aging in squirrel monkeys (Saimiri sciureus).
    Reproduction. 138: 793-9.
  7. Sobinoff, A.P. et al. (2011) Understanding the villain: DMBA induced pre-antral ovotoxicity involves selective follicular destruction and primordial follicle activation through PI3K/Akt and mTOR signalling.
    Toxicol Sci. 123: 563-75.
  8. Van Saen, D. et al. (2011) Can pubertal boys with Klinefelter syndrome benefit from spermatogonial stem cell banking?
    Hum Reprod. 27: 323-30.
  9. David, A. et al. (2012) Effect of cryopreservation and transplantation on the expression of kit ligand and anti-Müllerian hormone in human ovarian tissue
    Hum Reprod. 27: 1088-95.
  10. Kevenaar, M.E. et al. (2006) Serum anti-mullerian hormone levels reflect the size of the primordial follicle pool in mice.
    Endocrinology. 147: 3228-34.
  11. Campbell, B.K. et al. (2012) The role of anti-Müllerian hormone (AMH) during follicle development in a monovulatory species (sheep).
    Endocrinology. 153: 4533-43.
  12. Amorim, C.A. et al. (2013) Successful vitrification and autografting of baboon (Papio anubis) ovarian tissue.
    Hum Reprod. 28: 2146-56.
  13. Parlakgumus, H.A. et al. (2015) GNRH agonists and antagonists in rescue for cyclophosphamide-induced ovarian damage: friend or foe?
    Arch Gynecol Obstet. 291 (6): 1403-10.
  14. ThemmenA, P.N. et al. (2016) The use of anti-Müllerian hormone as diagnostic for gonadectomy status in dogs.
    Theriogenology. 86 (6): 1467-74.
  15. Saatcioglu, H.D. et al. (2016) Control of Oocyte Reawakening by Kit.
    PLoS Genet. 12 (8): e1006215.
  16. Calvopina, J.H. et al. (2015) The Aorta-Gonad-Mesonephros Organ Culture Recapitulates 5hmC Reorganization and Replication-Dependent and Independent Loss of DNA Methylation in the Germline.
    Stem Cells Dev. 24 (13): 1536-45.
  17. Camlin, N.J. et al. (2016) Maternal Smoke Exposure Impairs the Long-Term Fertility of Female Offspring in a Murine Model.
    Biol Reprod. 94 (2): 39.
  18. Ohta, K. et al. (2012) Male differentiation of germ cells induced by embryonic age-specific Sertoli cells in mice.
    Biol Reprod. 86 (4): 112.
  19. Bazzano, M.V. et al. (2015) Obesity induced by cafeteria diet disrupts fertility in the rat by affecting multiple ovarian targets.
    Reprod Biomed Online. 31 (5): 655-67.
  20. Díaz, P.U. et al. (2018) Altered Expression of Anti-Müllerian Hormone during the Early Stage of Bovine Persistent Ovarian Follicles.
    J Comp Pathol. 158: 22-31.
Win a $1000 antibody coupon*
View more products with AMH specificity