Browsing Modes for Business Users
Product Code Applications Pack Size List Price Your Price Qty
MCA2246
Datasheet Datasheet
SDS Safety Datasheet SDS
P * WB 1 ml loader
List Price Your Price
loader
MCA2246T
Datasheet Datasheet
SDS Safety Datasheet SDS
P * 0.1 ml loader
List Price Your Price
loader

Mouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.

AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric ~140 kDa disulphide linked precursor that is cleaved to release the mature ~30 kDa homodimer.

Target Species
Human
Species Cross-Reactivity
Target SpeciesCross Reactivity
Mouse
Sheep
Squirrel monkey
Baboon
Rat
N.B. Antibody reactivity and working conditions may vary between species.
Product Form
Concentrated tissue culture supernatant - liquid
Preparation
Concentrated Tissue Culture Supernatant containing 0.1M Tris/HCl pH7.4 and 5-10% foetal calf serum.
Preservative Stabilisers
0.1% sodium azide (NaN3)
Immunogen
Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Fusion Partners
Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma cell line.
Regulatory
For research purposes only
Guarantee
12 months from date of despatch

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Immunohistology - Paraffin 1 1/20 1/40
Western Blotting
  1. 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Histology Positive Control Tissue
human ovary

Description Product Code Applications Pack Size List Price Your Price Quantity
Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed) STAR117A E WB 0.5 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed)
Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed) STAR117D488GA F IF 0.1 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed)
Goat anti Mouse IgG (H/L):DyLight®550 (Multi Species Adsorbed) STAR117D550 F IF WB 0.1 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (H/L):DyLight®550 (Multi Species Adsorbed)
Goat anti Mouse IgG (H/L):DyLight®650 (Multi Species Adsorbed) STAR117D650 F IF 0.1 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (H/L):DyLight®650 (Multi Species Adsorbed)
Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed) STAR117D680GA F WB 0.1 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed)
Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed) STAR117D800GA F IF WB 0.1 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed)
Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed) STAR117F F 0.5 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed)
Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed) STAR117P C E WB 0.5 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed)
Goat anti Mouse IgG (Fc):FITC STAR120F C F 1 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (Fc):FITC
Goat anti Mouse IgG (Fc):HRP STAR120P E WB 1 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG (Fc):HRP
Rabbit F(ab')2 anti Mouse IgG:RPE STAR12A F 1 ml loader
List Price Your Price
loader
Description Rabbit F(ab')2 anti Mouse IgG:RPE
Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed) STAR13B C E P RE WB 1 mg loader
List Price Your Price
loader
Description Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed)
Goat anti Mouse IgG:FITC (Rat Adsorbed) STAR70 F 0.5 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG:FITC (Rat Adsorbed)
Goat anti Mouse IgG:RPE (Rat Adsorbed) STAR76 F 1 ml loader
List Price Your Price
loader
Description Goat anti Mouse IgG:RPE (Rat Adsorbed)
Goat anti Mouse IgG:HRP (Rat Adsorbed) STAR77 C E P 0.5 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG:HRP (Rat Adsorbed)
Goat anti Mouse IgG/A/M:HRP (Human Adsorbed) STAR87P E 1 mg loader
List Price Your Price
loader
Description Goat anti Mouse IgG/A/M:HRP (Human Adsorbed)
Rabbit F(ab')2 anti Mouse IgG:FITC STAR9B F 1 mg loader
List Price Your Price
loader
Description Rabbit F(ab')2 anti Mouse IgG:FITC

References for AMH antibody

  1. Van Saen, D. et al. (2010) Meiotic activity in orthotopic xenografts derived from human postpubertal testicular tissue.
    Hum Reprod. 26: 282-93.
  2. Gruijters, M.J et al. (2003) Anti-Müllerian hormone and its role in ovarian function.
    Mol Cell Endocrinol. 211 (1-2): 85-90.
  3. Weenen, C. et al. (2004) Anti-Mullerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle recruitment.
    Mol Hum Reprod10: 77-83.
  4. Papanastasopoulos, P. et al. (2009) A case of complete androgen insensitivity syndrome presenting with incarcerated inguinal hernia: an immunohistochemical study.
    Fertil Steril. 92: 1169.e11-4.
  5. Campbell, B.K. (2009) The endocrine and local control of ovarian follicle development in the ewe
    Anim. Reprod. 6:159-71
  6. Walker, M.L. et al. (2009) Ovarian aging in squirrel monkeys (Saimiri sciureus).
    Reproduction. 138: 793-9.
  7. Sobinoff, A.P. et al. (2011) Understanding the villain: DMBA induced pre-antral ovotoxicity involves selective follicular destruction and primordial follicle activation through PI3K/Akt and mTOR signalling.
    Toxicol Sci. 123: 563-75.
  8. Van Saen, D. et al. (2011) Can pubertal boys with Klinefelter syndrome benefit from spermatogonial stem cell banking?
    Hum Reprod. 27: 323-30.
  9. View The Latest Product References
  10. David, A. et al. (2012) Effect of cryopreservation and transplantation on the expression of kit ligand and anti-Müllerian hormone in human ovarian tissue
    Hum Reprod. 27: 1088-95.
  11. Kevenaar, M.E. et al. (2006) Serum anti-mullerian hormone levels reflect the size of the primordial follicle pool in mice.
    Endocrinology. 147: 3228-34.
  12. Campbell, B.K. et al. (2012) The role of anti-Müllerian hormone (AMH) during follicle development in a monovulatory species (sheep).
    Endocrinology. 153: 4533-43.
  13. Amorim, C.A. et al. (2013) Successful vitrification and autografting of baboon (Papio anubis) ovarian tissue.
    Hum Reprod. 28: 2146-56.
  14. Parlakgumus, H.A. et al. (2015) GNRH agonists and antagonists in rescue for cyclophosphamide-induced ovarian damage: friend or foe?
    Arch Gynecol Obstet. 291 (6): 1403-10.
  15. Themmen, A.P.N. et al. (2016) The use of anti-Müllerian hormone as diagnostic for gonadectomy status in dogs.
    Theriogenology. 86 (6): 1467-74.
  16. Saatcioglu, H.D. et al. (2016) Control of Oocyte Reawakening by Kit.
    PLoS Genet. 12 (8): e1006215.
  17. Calvopina, J.H. et al. (2015) The Aorta-Gonad-Mesonephros Organ Culture Recapitulates 5hmC Reorganization and Replication-Dependent and Independent Loss of DNA Methylation in the Germline.
    Stem Cells Dev. 24 (13): 1536-45.
  18. Camlin, N.J. et al. (2016) Maternal Smoke Exposure Impairs the Long-Term Fertility of Female Offspring in a Murine Model.
    Biol Reprod. 94 (2): 39.
  19. Ohta, K. et al. (2012) Male differentiation of germ cells induced by embryonic age-specific Sertoli cells in mice.
    Biol Reprod. 86 (4): 112.
  20. Bazzano, M.V. et al. (2015) Obesity induced by cafeteria diet disrupts fertility in the rat by affecting multiple ovarian targets.
    Reprod Biomed Online. 31 (5): 655-67.
  21. Díaz, P.U. et al. (2018) Altered Expression of Anti-Müllerian Hormone during the Early Stage of Bovine Persistent Ovarian Follicles.
    J Comp Pathol. 158: 22-31.
  22. Cacciottola, L. et al. (2020) Long-Term Advantages of Ovarian Reserve Maintenance and Follicle Development Using Adipose Tissue-Derived Stem Cells in Ovarian Tissue Transplantation.
    J Clin Med. 9 (9)Sep 15 [Epub ahead of print].
  23. Lv, X. et al. (2021) Effects of single and multiple transplantations of human umbilical cord mesenchymal stem cells on the recovery of ovarian function in the treatment of premature ovarian failure in mice.
    J Ovarian Res. 14 (1): 119.
  24. Wang, F. et al. (2013) Human amniotic epithelial cells can differentiate into granulosa cells and restore folliculogenesis in a mouse model of chemotherapy-induced premature ovarian failure.
    Stem Cell Res Ther. 4 (5): 124.
  25. de Michele, F. et al. (2018) In vitro. formation of the blood-testis barrier during long-term organotypic culture of human prepubertal tissue: comparison with a large cohort of pre/peripubertal boys.
    Mol Hum Reprod. 24 (5): 271-82.
  26. Meng, L. et al. (2023) Functional analysis of rare anti-Müllerian hormone protein-altering variants identified in women with PCOS.
    Mol Hum Reprod. 29 (5): gaad011.
  27. Amorim, C.A. et al. (2019) Long-term follow-up of vitrified and autografted baboon (Papio anubis) ovarian tissue.
    Hum Reprod. 34 (2): 323-334.
  28. Van Saen, D. et al. (2020) Characterization of the stem cell niche components within the seminiferous tubules in testicular biopsies of Klinefelter patients.
    Fertil Steril. 113 (6): 1183-95.e3.
  29. Sarrible, G.B. et al. (2025) Effects of coenzyme q10 supplementation on metabolic and reproductive outcomes in obese rats.
    J Ovarian Res. 18 (1): 22.
  30. Alvaro Mercadal, B. et al. (2015) AMH mutations with reduced in vitro bioactivity are related to premature ovarian insufficiency.
    Hum Reprod. 30 (5): 1196-202.
  31. Parlakgumus, H.A. et al. (2014) Atorvastatin for ovarian torsion: effects on follicle counts, AMH, and VEGF expression.
    Eur J Obstet Gynecol Reprod Biol. 175: 186-90.
  32. Hervet, C. et al. (2025) Differential impact of porcine reproductive and respiratory virus and swine Influenza A virus infections on respiratory Lymph Nodes B cells and macrophages.
    Mol Immunol. 188: 98-110.

Immunohistology - Paraffin

Synonyms
anti Mullerian Hormone
RRID
AB_2226471
UniProt
P03971
Entrez Gene
AMH
GO Terms
GO:0001880 Mullerian duct regression
GO:0005179 hormone activity
GO:0005615 extracellular space
GO:0007267 cell-cell signaling
GO:0007506 gonadal mesoderm development
GO:0007530 sex determination
GO:0008083 growth factor activity
GO:0030154 cell differentiation

MCA2246

PDF 153561 PDF 163291 PDF 180510

MCA2246T

PDF 153562 PDF 164109 PDF 180510

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

Request a different product with this specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

View all Anti-Human Products