AMH antibody | 5/6
Mouse anti Human AMH antibody, clone 5/6 used to demonstrate mouse ovarian granulosa cells expressing anti Müllerian Hormone by immunohistochemistry on formalin fixed, paraffin embedded tissue secteions
Image caption:
Marker studies of Kit-deficient oocytes are consistent with specific defect in oocyte reawakening via Foxo3. (A) Immunohistochemistry for markers as shown at 6 weeks of age; slides counterstained with hematoxylin. Note absence of P-AKT (in contrast to D818V mutant) and constitutively nuclear localization of Foxo3. Scale bars = 25 μm; all panels at same magnification. (B) Immunofluorescence detection of Foxo3 protein; slides counterstained with DAPI. Foxo3 undergoes nuclear to cytoplasmic export in wild-type primary follicles but is constitutively nuclear in the mutant. Scale bar = 10 μm, same for all panels. (C) Analysis of granulosa cells in wild-type and VC; KitL/- ovaries. Immunohistochemistry for markers as shown at 6 wks of age; slides counterstained with hematoxylin. Scale bars = 200 μm in large panels, or 25 μm in small panels; all small panels at same magnification. (D) Absence of Gata1-positive cells in aberrant follicles in VC; KitL/- ovaries. Wild-type testis is shown as a positive control (Gata1 is expressed in Sertoli cells). Scale bar = 25 μm; both panels at same magnification.
From: Saatcioglu HD, Cuevas I, Castrillon DH (2016)
Control of Oocyte Reawakening by Kit.
PLoS Genet 12(8): e1006215.
This image is from an open access article distributed under terms of a Creative Commons Attribution License.
Mouse anti Human AMH antibody, clone 5/6 used to demonstrate mouse ovarian granulosa cells expressing anti Müllerian Hormone by immunohistochemistry on formalin fixed, paraffin embedded tissue secteions
Image caption:
Loss of the primordial follicle pool due to oocyte reawakening.
(A) Oocyte reawakening phenotype at PD7 and PD28. Immunohistochemistry for markers as shown; slides counterstained with hematoxylin. White arrows indicate follicles with atretic (Sall4-negative) oocytes; black arrows indicate AMH-negative granulosa cells. Scale bar = 25 μm; all panels at same magnification. (B) Serum FSH and LH levels of VC; KitD818V(L)/+ and control females at five months of age. *p<0.05, **p<0.01; unpaired student t test; n = 3 animals per genotype. (C) Toluidine-blue stained sections of plastic-embedded ovaries from experimental and sibling controls at 6 weeks of age; scale bar = 10 μm, both panels at same magnification. The follicle shown on the right does not contain a viable oocyte.
From: Saatcioglu HD, Cuevas I, Castrillon DH (2016)
Control of Oocyte Reawakening by Kit.
PLoS Genet 12(8): e1006215.
This image is from an open access article distributed under terms of a Creative Commons Attribution License.
Mouse anti Human AMH antibody, clone 5/6 (MCA2246) used for the demonstration of anti Müllerian hormone expressing cells in grafted human ovarian tissue by immunohistochemistry on formalin fixed, paraffin embedded sections.
Image caption:
(A) AMH, (B) AMHRII, (C) ERα, and (D) ERβ staining concentrations (mean ± SEM) comparisons between groups (non-grafted controls, OT, and 2-step/ASCs+OT), and follicle stages (primordial, primary, secondary, and antral) were analyzed using Kruskal–Wallis and Fisher’s post hoc LSD tests. Significant differences between groups are indicated as follows: * p <0.05; *** p <0.001. AMH: anti-Müllerian hormone. AMHRII: anti-Müllerian hormone receptor type II. ER: estrogen receptor. OT: ovarian tissue. ASCs: adipose tissue-derived stem cells. Scale bars: 100 μm.
From: Cacciottola, L.; Nguyen, T.Y.T.; Chiti, M.C.; Camboni, A.; Amorim, C.A.; Donnez, J.; Dolmans, M.-M.
Long-Term Advantages of Ovarian Reserve Maintenance and Follicle Development Using Adipose Tissue-Derived Stem Cells in Ovarian Tissue Transplantation.
J. Clin. Med. 2020, 9, 2980.
This image is from an open access article distributed under terms of a Creative Commons Attribution License.
Mouse anti Human AMH, clone 5/6 (MCA2246) used to evaluate AMH expression in murine ovarian tissues by immunohistochemistry.
Image caption:
The ovarian reserve capacity analysis. Immunohistochemistry for AMH in once intravenous group. Strong expression of AMH were seen in Sham group at each time point, granulosa cells were negative in POF group, AMH expression reappeared in ovaries from MSCs group. Original magnication: 100×.
From: Effects of Single Transplantation and Multiple Transplantation of Human Umbilical Cord Mesenchymal Stem Cells on the Recovery of Ovarian Function in the Treatment of Premature Ovarian Failure in Mice.
Lv, X. et al.
Res Sq; Dec 01 [Preprint, Epub ahead of print].
10.21203/rs.3.rs-115773/v1
This image is from an open access article distributed under terms of a Creative Commons Attribution License.
Mouse anti Human AMH, clone 5/6 (MCA2246) used to evaluate AMH expression in murine ovarian tissues by immunohistochemistry.
Image caption:
The ovarian reserve capacity analysis. Immunohistochemistry for AMH in the multiple intravenous group (b). Strong expression of AMH were seen in Sham group at each time point, granulosa cells were negative in POF group, AMH expression reappeared in ovaries from MSCsgroup. Original magnication: 100×.
From: Effects of Single Transplantation and Multiple Transplantation of Human Umbilical Cord Mesenchymal Stem Cells on the Recovery of Ovarian Function in the Treatment of Premature Ovarian Failure in Mice.
Lv, X. et al.
Res Sq; Dec 01 [Preprint, Epub ahead of print].
10.21203/rs.3.rs-115773/v1
This image is from an open access article distributed under terms of a Creative Commons Attribution License.
Mouse anti Human AMH antibody, clone 5/6 (MCA2246) used to show AMH expression in murine ovarian tissue by immunohistochemistry on formalin fixed, paraffin embedded tissue sections.
Image caption:
AMH expression in recipient mouse ovaries. (A) AMH was expressed in all granulosa cells of primary, preantral and small antral follicles in normal ovaries. (B) AMH expression disappeared in stromal and atretic follicles in recipients ovaries without hAECs transplantation two months after chemotherapy. (C) AMH expression was negative in recipient ovaries seven days after hAEC transplantation. However, AMH expressions were detected in recipient ovaries after hAEC transplantation for 14 days (D) and 21 days (E). (F) AMH expression patterns are strong in recipient ovaries two months after hAEC transplantation; data are consistent with that from control normal ovaries. Scale bars = 100 μm. AMH, Anti-Müllerian hormone; hAEC, human amniotic epithelial cell.
From: Wang F, Wang L, Yao X, Lai D, Guo L.
Human amniotic epithelial cells can differentiate into granulosa cells and restore folliculogenesis in a mouse model of chemotherapy-induced premature ovarian failure.
Stem Cell Res Ther. 2013 Oct 14;4(5):124.
doi: 10.1186/scrt335.
This image is from an open access article distributed under terms of a Creative Commons Attribution License.
Filter by Application:
P ResetMouse anti Human AMH
- Product Type
- Monoclonal Antibody
- Clone
- 5/6
- Isotype
- IgG1
- Specificity
- AMH
Quick Links:
Antibody Quality and 
Unrivaled 
| Mouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric ~140 kDa disulphide linked precursor that is cleaved to release the mature ~30 kDa homodimer. |
- Target Species
- Human
- Species Cross-Reactivity
-
Target Species Cross Reactivity Mouse Sheep Squirrel monkey Baboon - N.B. Antibody reactivity and working conditions may vary between species.
- Product Form
- Concentrated tissue culture supernatant - liquid
- Preparation
- Concentrated Tissue Culture Supernatant containing 0.1M Tris/HCl pH7.4 and 5-10% foetal calf serum.
- Preservative Stabilisers
- 0.1% sodium azide (NaN3)
- Immunogen
- Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
- Fusion Partners
- Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma cell line.
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
| Application Name | Verified | Min Dilution | Max Dilution |
|---|---|---|---|
| Immunohistology - Paraffin 1 |  |
1/20 | 1/40 |
| Western Blotting | |
- 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- Histology Positive Control Tissue
- human ovary
References for AMH antibody
-
Van Saen, D. et al. (2010) Meiotic activity in orthotopic xenografts derived from human postpubertal testicular tissue.
Hum Reprod. 26: 282-93. -
Gruijters, M.J et al. (2003) Anti-Müllerian hormone and its role in ovarian function.
Mol Cell Endocrinol. 211 (1-2): 85-90. -
Weenen, C. et al. (2004) Anti-Mullerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle recruitment.
Mol Hum Reprod10: 77-83. -
Papanastasopoulos, P. et al. (2009) A case of complete androgen insensitivity syndrome presenting with incarcerated inguinal hernia: an immunohistochemical study.
Fertil Steril. 92: 1169.e11-4. -
Campbell, B.K. (2009) The endocrine and local control of ovarian follicle development in the ewe
Anim. Reprod. 6:159-71 -
Walker, M.L. et al. (2009) Ovarian aging in squirrel monkeys (Saimiri sciureus).
Reproduction. 138: 793-9. -
Sobinoff, A.P. et al. (2011) Understanding the villain: DMBA induced pre-antral ovotoxicity involves selective follicular destruction and primordial follicle activation through PI3K/Akt and mTOR signalling.
Toxicol Sci. 123: 563-75. -
Van Saen, D. et al. (2011) Can pubertal boys with Klinefelter syndrome benefit from spermatogonial stem cell banking?
Hum Reprod. 27: 323-30.
View The Latest Product References
-
David, A. et al. (2012) Effect of cryopreservation and transplantation on the expression of kit ligand and anti-Müllerian hormone in human ovarian tissue
Hum Reprod. 27: 1088-95. -
Kevenaar, M.E. et al. (2006) Serum anti-mullerian hormone levels reflect the size of the primordial follicle pool in mice.
Endocrinology. 147: 3228-34. -
Campbell, B.K. et al. (2012) The role of anti-Müllerian hormone (AMH) during follicle development in a monovulatory species (sheep).
Endocrinology. 153: 4533-43. -
Amorim, C.A. et al. (2013) Successful vitrification and autografting of baboon (Papio anubis) ovarian tissue.
Hum Reprod. 28: 2146-56. -
Parlakgumus, H.A. et al. (2015) GNRH agonists and antagonists in rescue for cyclophosphamide-induced ovarian damage: friend or foe?
Arch Gynecol Obstet. 291 (6): 1403-10. -
ThemmenA, P.N. et al. (2016) The use of anti-Müllerian hormone as diagnostic for gonadectomy status in dogs.
Theriogenology. 86 (6): 1467-74. -
Saatcioglu, H.D. et al. (2016) Control of Oocyte Reawakening by Kit.
PLoS Genet. 12 (8): e1006215. -
Calvopina, J.H. et al. (2015) The Aorta-Gonad-Mesonephros Organ Culture Recapitulates 5hmC Reorganization and Replication-Dependent and Independent Loss of DNA Methylation in the Germline.
Stem Cells Dev. 24 (13): 1536-45. -
Camlin, N.J. et al. (2016) Maternal Smoke Exposure Impairs the Long-Term Fertility of Female Offspring in a Murine Model.
Biol Reprod. 94 (2): 39. -
Ohta, K. et al. (2012) Male differentiation of germ cells induced by embryonic age-specific Sertoli cells in mice.
Biol Reprod. 86 (4): 112. -
Bazzano, M.V. et al. (2015) Obesity induced by cafeteria diet disrupts fertility in the rat by affecting multiple ovarian targets.
Reprod Biomed Online. 31 (5): 655-67. -
Díaz, P.U. et al. (2018) Altered Expression of Anti-Müllerian Hormone during the Early Stage of Bovine Persistent Ovarian Follicles.
J Comp Pathol. 158: 22-31. -
Cacciottola, L. et al. (2020) Long-Term Advantages of Ovarian Reserve Maintenance and Follicle Development Using Adipose Tissue-Derived Stem Cells in Ovarian Tissue Transplantation.
J Clin Med. 9 (9)Sep 15 [Epub ahead of print]. -
Lv, X. et al. (2020) Effects of Single Transplantation and Multiple Transplantation of Human Umbilical Cord Mesenchymal Stem Cells on the Recovery of Ovarian Function in the Treatment of Premature Ovarian Failure in Mice
Res Sq; Dec 01 [Preprint, Epub ahead of print]. -
Wang, F. et al. (2013) Human amniotic epithelial cells can differentiate into granulosa cells and restore folliculogenesis in a mouse model of chemotherapy-induced premature ovarian failure.
Stem Cell Res Ther. 4 (5): 124. -
de Michele, F. et al. (2018) In vitro. formation of the blood-testis barrier during long-term organotypic culture of human prepubertal tissue: comparison with a large cohort of pre/peripubertal boys.
Mol Hum Reprod. 24 (5): 271-82.
- Synonyms
- anti Mullerian Hormone
- RRID
- AB_2226471
- UniProt
- P03971
- Entrez Gene
- AMH
- GO Terms
- GO:0001880 Mullerian duct regression
- GO:0005179 hormone activity
- GO:0005615 extracellular space
- GO:0007267 cell-cell signaling
- GO:0007506 gonadal mesoderm development
- GO:0007530 sex determination
- GO:0008083 growth factor activity
- GO:0030154 cell differentiation
Request a different product with this specificity
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Human ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up