AMH Antibody | 5/6

AMH Antibody | 5/6 gallery image 1

Formalin fixed, paraffin embedded ovarian tissue section from a 25 day old mouse stained with Mouse anti Human anti Müllarian Hormone antibody, clone 5/6 (MCA2246).

AMH Antibody | 5/6 gallery image 2

Published customer image:
Mouse anti Human AHP antibody, clone 5/6 used to demonstrate mouse ovarian granulosa cells expressing anti Müllerian Hormone by immunohistochemistry on formalin fixed, paraffin embedded tissue secteions
Image caption:
Marker studies of Kit-deficient oocytes are consistent with specific defect in oocyte reawakening via Foxo3. (A) Immunohistochemistry for markers as shown at 6 weeks of age; slides counterstained with hematoxylin. Note absence of P-AKT (in contrast to D818V mutant) and constitutively nuclear localization of Foxo3. Scale bars = 25 μm; all panels at same magnification. (B) Immunofluorescence detection of Foxo3 protein; slides counterstained with DAPI. Foxo3 undergoes nuclear to cytoplasmic export in wild-type primary follicles but is constitutively nuclear in the mutant. Scale bar = 10 μm, same for all panels. (C) Analysis of granulosa cells in wild-type and VC; KitL/- ovaries. Immunohistochemistry for markers as shown at 6 wks of age; slides counterstained with hematoxylin. Scale bars = 200 μm in large panels, or 25 μm in small panels; all small panels at same magnification. (D) Absence of Gata1-positive cells in aberrant follicles in VC; KitL/- ovaries. Wild-type testis is shown as a positive control (Gata1 is expressed in Sertoli cells). Scale bar = 25 μm; both panels at same magnification.

From: Saatcioglu HD, Cuevas I, Castrillon DH (2016),br.Control of Oocyte Reawakening by Kit.
PLoS Genet 12(8): e1006215.

AMH Antibody | 5/6 gallery image 3

Published customer image:
Mouse anti Human AHP antibody, clone 5/6 used to demonstrate mouse ovarian granulosa cells expressing anti Müllerian Hormone by immunohistochemistry on formalin fixed, paraffin embedded tissue secteions
Image caption:
Loss of the primordial follicle pool due to oocyte reawakening.
(A) Oocyte reawakening phenotype at PD7 and PD28. Immunohistochemistry for markers as shown; slides counterstained with hematoxylin. White arrows indicate follicles with atretic (Sall4-negative) oocytes; black arrows indicate AMH-negative granulosa cells. Scale bar = 25 μm; all panels at same magnification. (B) Serum FSH and LH levels of VC; KitD818V(L)/+ and control females at five months of age. *p<0.05, **p<0.01; unpaired student t test; n = 3 animals per genotype. (C) Toluidine-blue stained sections of plastic-embedded ovaries from experimental and sibling controls at 6 weeks of age; scale bar = 10 μm, both panels at same magnification. The follicle shown on the right does not contain a viable oocyte.

From: Saatcioglu HD, Cuevas I, Castrillon DH (2016),br.Control of Oocyte Reawakening by Kit.
PLoS Genet 12(8): e1006215.

  • AMH Antibody | 5/6 thumbnail image 1
  • AMH Antibody | 5/6 thumbnail image 2
  • AMH Antibody | 5/6 thumbnail image 3
  • Mouse anti Human AMH
  • Mouse anti Human AMH
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
  • Isotype
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    MCA2246TP *datasheet pdfdatasheet pdf0.1 ml
    MCA2246P *, WBdatasheet pdfdatasheet pdf1 ml
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • Mouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.

      AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140 kDa disulphide linked precursor that is cleaved to release the mature 30 kDa homodimer.
    • Intended Use
    • Target Species
    • Species Cross-Reactivity
      Target SpeciesCross Reactivity
      Squirrel monkeyyes
      N.B. Antibody reactivity and working conditions may vary between species.
    • Product Form
      Concentrated Tissue Culture Supernatant - liquid
      Concentrated Tissue Culture Supernatant - liquid
    • Reconstitution
    • Preparation
    • Preservative Stabilisers
      0.1%Sodium Azide
      0.1%Sodium Azide
    • Immunogen
      Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
    • Purity
    • Approx. Protein Concentrations
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
    • Fusion Partners
      Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma cell line.
    • Storage
      Store at +4oC or at -20oC if preferred.

      This product should be stored undiluted.

      Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Store at +4oC or at -20oC if preferred.

      This product should be stored undiluted.

      Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      18 months from date of despatch
      18 months from date of despatch.
    • GO Terms
      growth factor activity
      extracellular space
      cell differentiation
      hormone activity
      sex determination
      gonadal mesoderm development
      cell-cell signaling
      Mullerian duct regression
    • UniProt
    • Entrez Gene
    • Acknowledgements
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Western Blotting
      Immunohistology - Paraffin(1)1/201/40
      This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.
    • Application NameYesNoMin DilutionMax Dilution
      Western Blotting
      Immunohistology - Paraffin(1)1/201/40
      This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
    • Technical Advice
    • Recommended Protocol
    • Recommended Protocol
    • ELISA
    • ELISA
    • Immunohistology
    • Immunohistology
    • Histology Positive Control Tissue
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Immunofluorescence
    • Western Blotting
    • Western Blotting
    • Instructions For Use
    • Instructions For Use

    Additional AMH Antibody Formats

    Formats Clone Applications Sizes available
    AMH Antibody : Con S/N 5/6 P *, WB 1 ml | 0.1 ml
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed)STAR117A0.5 mgE, WB
      Goat anti Mouse IgG/A/M:Alk. Phos.STAR87A1 mgC, E, WB
      Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed)STAR117D488GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed)STAR117D549GA0.1 mgF, IF, WB
      Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed)STAR117D649GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed)STAR117D680GA0.1 mgF, WB
      Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed)STAR117D800GA0.1 mgF, IF, WB
      Rabbit F(ab')2 anti Mouse IgG:Dylight®800STAR8D800GA0.1 mgF, IF, WB
      Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed)STAR117F0.5 mgF
      Goat anti Mouse IgG:FITC (Rat Adsorbed)STAR700.5 mgF
      Goat anti Mouse IgG (Fc):FITCSTAR120F1 mgC, F
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      Human anti Mouse IgG1:HRPHCA036P0.1 mgE
      Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed)STAR117P0.5 mgE, WB
      Goat anti Mouse IgG:HRP (Rat Adsorbed)STAR770.5 mgC, E, P
      Goat anti Mouse IgG (Fc):HRPSTAR120P1 mgE, WB
      Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed)STAR13B1 mgC, E, P, RE, WB
      Goat anti Mouse IgG/A/M:HRP (Human Adsorbed)STAR87P1 mgE
      Rabbit F(ab')2 anti Mouse IgG:RPESTAR12A1 mlF
      Goat anti Mouse IgG:RPE (Rat Adsorbed)STAR761 mlF
      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed)STAR117A0.5 mgE, WB
      Goat anti Mouse IgG/A/M:Alk. Phos.STAR87A1 mgC, E, WB
      Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed)STAR117D488GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed)STAR117D549GA0.1 mgF, IF, WB
      Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed)STAR117D649GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed)STAR117D680GA0.1 mgF, WB
      Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed)STAR117D800GA0.1 mgF, IF, WB
      Rabbit F(ab')2 anti Mouse IgG:Dylight®800STAR8D800GA0.1 mgF, IF, WB
      Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed)STAR117F0.5 mgF
      Goat anti Mouse IgG:FITC (Rat Adsorbed)STAR700.5 mgF
      Goat anti Mouse IgG (Fc):FITCSTAR120F1 mgC, F
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      Human anti Mouse IgG1:HRPHCA036P0.1 mgE
      Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed)STAR117P0.5 mgE, WB
      Goat anti Mouse IgG:HRP (Rat Adsorbed)STAR770.5 mgC, E, P
      Goat anti Mouse IgG (Fc):HRPSTAR120P1 mgE, WB
      Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed)STAR13B1 mgC, E, P, RE, WB
      Goat anti Mouse IgG/A/M:HRP (Human Adsorbed)STAR87P1 mgE
      Rabbit F(ab')2 anti Mouse IgG:RPESTAR12A1 mlF
      Goat anti Mouse IgG:RPE (Rat Adsorbed)STAR761 mlF

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              • Application NameReference Images
                Immunohistology - Frozen
                Immunohistology - Paraffin
                Western Blotting


              Write your review

              You may also be interested in...