Pertuzumab antibody | AbD35668

Human anti Pertuzumab

Product Type
Monoclonal Antibody
Clone
AbD35668
Isotype
HuCAL Fab monovalent
Specificity
Pertuzumab

Product Code Applications Pack Size List Price Your Price Qty
HCA341
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E 0.1 mg loader
List Price Your Price
loader
Search for Batch Specific Datasheets

Human Anti-Pertuzumab Antibody, clone AbD35668 is a paratope specific, inhibitory anti-idiotypic antibody that specifically recognizes the humanized monoclonal antibody pertuzumab. It does not recognize free human epidermal growth factor receptor 2 (HER2) nor pertuzumab in complex with HER2. The antibody can be used to measure pertuzumab or its biosimilars in patient samples.

Clone AbD35668 is a fully human recombinant monoclonal antibody in monovalent Fab format and is suitable as the capture antibody in a pharmacokinetic (PK) bridging ELISA.

Pertuzumab (Perjeta) is an IgG1/kappa antibody humanized from mouse. It has been approved for the treatment of patients with metastatic HER2-positive breast cancer in combination with trastuzumab. Pertuzumab binds to the extracellular domain II of HER2 and inhibits HER2–HER3 dimerization, reducing signaling through intracellular pathways (Capelan et al. 2013).

View a summary of all anti-pertuzumab antibodies

Product Form
A monovalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
Preparation
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
Immunogen
Pertuzumab
Affinity
The monovalent intrinsic affinity of AbD35668 was measured as KD = 14 nM by real time, label free molecular interaction analysis on immobilized pertuzumab.
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml
Regulatory
For research purposes only
Guarantee
12 months from date of despatch
Acknowledgements
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Perjeta is a trademark of Genentech, Inc.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
ELISA
Clone AbD35668 can be used in an indirect ELISA or as capture antibody for pertuzumab in a bridging ELISA.

Description Product Code Applications Pack Size List Price Your Price Quantity
Hispec Assay Diluent BUF049A E IY 50 ml
List Price Your Price
Description Hispec Assay Diluent
Human anti Pertuzumab HCA342 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Pertuzumab
Human anti Pertuzumab HCA344 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Pertuzumab
Human anti Pertuzumab HCA345 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Pertuzumab
LYNX Rapid HRP Antibody Conjugation Kit LNK002P CJ 3 Conjugations For 400µg Antibody
List Price Your Price
Description LYNX Rapid HRP Antibody Conjugation Kit

Further Reading

  1. Capelan, M. et al. (2013) Pertuzumab: new hope for patients with HER2-positive breast cancer.
    Ann Oncol. 24 (2): 273-282.

Synonyms
Perjeta
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
View more products with Pertuzumab specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"