Pertuzumab antibody | AbD35668

100% Secure


Human anti Pertuzumab

Product Type
Monoclonal Antibody
Clone
AbD35668
Isotype
HuCAL Fab monovalent
Product Code Applications Pack Size List Price Quantity
HCA341
Datasheet
E
SDS
0.1 mg loader

Human Anti-Pertuzumab Antibody, clone AbD35668 is a paratope specific, inhibitory anti-idiotypic antibody that specifically recognizes the humanized monoclonal antibody pertuzumab. It does not recognize free human epidermal growth factor receptor 2 (HER2) nor pertuzumab in complex with HER2. The antibody can be used to measure pertuzumab or its biosimilars in patient samples.

Clone AbD35668 is a fully human recombinant monoclonal antibody in monovalent Fab format and is suitable as the capture antibody in a pharmacokinetic (PK) bridging ELISA.

Pertuzumab (Perjeta) is an IgG1/kappa antibody humanized from mouse. It has been approved for the treatment of patients with metastatic HER2-positive breast cancer in combination with trastuzumab. Pertuzumab binds to the extracellular domain II of HER2 and inhibits HER2–HER3 dimerization, reducing signaling through intracellular pathways (Capelan et al. 2013).

View a summary of all anti-pertuzumab antibodies

Product Details

Product Form
A monovalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
Preparation
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
Immunogen
Pertuzumab
Affinity
The monovalent intrinsic affinity of AbD35668 was measured as KD = 14 nM by real time, label free molecular interaction analysis on immobilized pertuzumab.
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml

Storage Information

Storage
This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Guarantee
12 months from date of despatch

More Information

Acknowledgements
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Perjeta is a trademark of Genentech, Inc.
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
Regulatory
For research purposes only

Applications of Pertuzumab antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
ELISA
Clone AbD35668 can be used in an indirect ELISA or as capture antibody for pertuzumab in a bridging ELISA.

Useful Reagents Available

Description Product Code Applications Pack Size List Price Quantity
Hispec Assay Diluent BUF049A E IY 50 ml
Human anti Pertuzumab HCA342 E 0.1 mg loader
Human anti Pertuzumab HCA344 E 0.1 mg loader
Human anti Pertuzumab HCA345 E 0.1 mg loader
LYNX Rapid HRP Antibody Conjugation Kit LNK002P CJ 3 Conjugations For 400µg Antibody

Product Specific References

Further Reading

  1. Capelan, M. et al. (2013) Pertuzumab: new hope for patients with HER2-positive breast cancer.
    Ann Oncol. 24 (2): 273-282.

Fluorescent Spectraviewer

Watch the Tool Tutorial Video ▸

How to Use the Spectraviewer

Watch the Tool Tutorial Video ▸
  • Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
  • Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
  • Select the lasers and filters you wish to include
  • Select combined or multi-laser view to visualize the spectra