Ipilimumab antibody | AbD34433

Human anti Ipilimumab

Product Type
Monoclonal Antibody
HuCAL Fab monovalent

Product Code Applications Pack Size List Price Your Price Qty
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E 0.1 mg loader
List Price Your Price

Human Anti-Ipilimumab Antibody, clone AbD34433 is a paratope specific, inhibitory anti-idiotypic antibody that specifically recognizes the monoclonal antibody ipilimumab. It does not recognize free human CTLA-4 (cytotoxic T-lymphocyte antigen-4) or ipilimumab in complex with CTLA-4. The antibody can be used to measure free ipilimumab in patient samples.

A pair of anti-ipilimumab antibodies can be used to develop a pharmacokinetic (PK) bridging assay to measure free drug. This antibody, in monovalent Fab format, is recommended as the capture antibody, paired with an HRP conjugated Anti-Ipilimumab Antibody in full immunoglobulin format, clone AbD34429ia (HCA329P) as the detection antibody.

Ipilimumab (Yervoy) is a human IgG1/kappa antibody developed from a transgenic mouse. It has been approved by the FDA for the treatment of metastatic melanoma, renal cell carcinoma, and in combination with nivolumab for the treatment of previously treated microsatellite instability-high/deficient mismatch repair (MSI-H/dMMR) metastatic colorectal cancer. Ipilimumab activates the immune system by targeting CTLA-4, a protein receptor that downregulates the immune system. The action of cytotoxic T lymphocytes (CTLs) to recognize and destroy cancer cells is subject to an inhibitory mechanism that interrupts this destruction. Ipilimumab turns off this inhibitory mechanism and allows CTLs to function.

View a summary of all anti-ipilimumab antibodies

Product Form
A monovalent human recombinant Fab (kappa light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
The intrinsic affinity of the monovalent form of Human anti Ipilimumab antibody, clone AbD34433 is KD = 0.3 nM as measured by real time, label free molecular interaction analysis on immobilized Ipilimumab.
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml
For research purposes only
12 months from date of despatch
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Yervoy is a trademark of Bristol-Myers Squibb Company.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
Human anti Ipilimumab antibody, clone AbD34433 can be used in an indirect ELISA or as a capture antibody in a sandwich ELISA together with HCA329P as the detection reagent.

Protocol: PK bridging ELISA.

Description Product Code Applications Pack Size List Price Your Price Quantity
Rat anti DYKDDDDK Tag:HRP MCA4764P E P WB 0.1 mg loader
List Price Your Price
Description Rat anti DYKDDDDK Tag:HRP

Description Product Code Applications Pack Size List Price Your Price Quantity
LYNX Rapid HRP Antibody Conjugation Kit LNK002P CJ 3 Conjugations For 400µg Antibody
List Price Your Price
Description LYNX Rapid HRP Antibody Conjugation Kit
Hispec Assay Diluent BUF049A E IY 50 ml
List Price Your Price
Description Hispec Assay Diluent
Human anti Ipilimumab HCA327 E 0.1 mg loader
List Price Your Price
Description Human anti Ipilimumab
Human anti Ipilimumab HCA328 E 0.1 mg loader
List Price Your Price
Description Human anti Ipilimumab
Human anti Ipilimumab HCA329 E 0.1 mg loader
List Price Your Price
Description Human anti Ipilimumab
Human anti Ipilimumab (Drug/Target Complex) HCA331 E 0.1 mg loader
List Price Your Price
Description Human anti Ipilimumab (Drug/Target Complex)

Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.



If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

View more products with Ipilimumab specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"