Ipilimumab antibody | AbD34294

100% Secure

Human anti Ipilimumab (Drug/Target Complex)

Product Type
Monoclonal Antibody
HuCAL Fab monovalent
Product Code Applications Pack Size List Price Quantity
0.1 mg loader

Human Anti-Ipilimumab Antibody, clone AbD34294 specifically recognizes the monoclonal antibody drug ipilimumab when in complex with its target, CTLA-4 (cytotoxic T-lymphocyte antigen-4). The antibody does not recognize free ipilimumab or unbound recombinant human CTLA-4. It can be used to measure levels of ipilimumab in patient samples.

Clone AbD34294 is a monovalent Fab format antibody that can be used to develop a pharmacokinetic (PK) antigen capture assay to measure free ipilimumab captured via immobilized CTLA-4.

Ipilimumab (Yervoy) is a human IgG1/kappa antibody developed from a transgenic mouse. It has been approved by the FDA for the treatment of metastatic melanoma, renal cell carcinoma, and in combination with nivolumab for the treatment of previously treated microsatellite instability-high/deficient mismatch repair (MSI-H/dMMR) metastatic colorectal cancer. Ipilimumab activates the immune system by targeting CTLA-4, a protein receptor that downregulates the immune system. The action of cytotoxic T lymphocytes (CTLs) to recognize and destroy cancer cells is subject to an inhibitory mechanism that interrupts this destruction. Ipilimumab turns off this inhibitory mechanism and allows CTLs to function.

View a summary of all anti-ipilimumab antibodies

Product Details

Product Form
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
The monovalent intrinsic affinity of AbD34294 was measured as KD = 252 nM by real time, label free molecular interaction analysis on immobilized CTLA-4/ipilimumab complex.
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml

Storage Information

Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
12 months from date of despatch

More Information

Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Yervoy is a trademark of Bristol-Myers Squibb Company.
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
For research purposes only

Applications of Ipilimumab antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Clone AbD34294 is recommended for use as the detection reagent in an antigen capture assay to measure free ipilimumab captured via immobilized CTLA-4.

Protocol: PK antigen capture ELISA to measure bound drug exclusively

Secondary Antibodies Available

Description Product Code Applications Pack Size List Price Quantity
Rat anti DYKDDDDK Tag:HRP MCA4764P E P WB 0.1 mg loader

Useful Reagents Available

Description Product Code Applications Pack Size List Price Quantity
Hispec Assay Diluent BUF049A E IY 50 ml
Human anti Ipilimumab HCA327 E 0.1 mg loader
Human anti Ipilimumab HCA328 E 0.1 mg loader
Human anti Ipilimumab HCA329 E 0.1 mg loader
Human anti Ipilimumab HCA330 E 0.1 mg loader
LYNX Rapid HRP Antibody Conjugation Kit LNK002P CJ 3 Conjugations For 400µg Antibody

Fluorescent Spectraviewer

Watch the Tool Tutorial Video ▸

How to Use the Spectraviewer?

Watch the Tool Tutorial Video ▸

  • Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
  • Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
  • Select the lasers and filters you wish to include
  • Select combined or multi-laser view to visualize the spectra