Browsing Modes for Business Users

Infliximab antibody | AbD17837

Human anti Infliximab

Product Type
Monoclonal Antibody
Clone
AbD17837
Isotype
HuCAL Fab monovalent
Specificity
Infliximab

Product Code Applications Pack Size List Price Your Price Qty
HCA212
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E 0.1 mg
List Price Your Price
HCA212G
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E 1 mg
List Price Your Price

Human Anti-Infliximab, clone AbD17837, is an anti-idiotypic antibody that specifically recognizes the infliximab monoclonal antibody and inhibits the binding of infliximab to its target. It can be used in bioanalytical assays to measure the levels of infliximab and biosimilar products, such as Inflectra and Renflexis, in patient samples.

Infliximab (branded as Remicade) is a chimeric monoclonal antibody drug (IgG1/kappa) that has been approved for treatment of psoriasis, Crohn's disease, ankylosing spondylitis, psoriatic arthritis, rheumatoid arthritis, and ulcerative colitis.

Infliximab is directed against Tumour Necrosis Factor Alpha (TNFα) and acts by blocking the binding of this cytokine to its receptors. Infliximab also induces apoptosis of TNFα expressing T-lymphocytes.

View a summary of all Anti-Infliximab Antibodies.

Product Form
Pack Size: 0.1 mg
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
Pack Size: 1 mg
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
Preparation
StrepTactin affinity chromatography
Source
E.coli
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
Immunogen
Infliximab
Affinity
The monovalent intrinsic affinity of this antibody is KD=3.2 nM as measured by real time, label-free molecular interaction analysis on immobilized infliximab.
Approx. Protein Concentrations
Pack Size: 0.1 mg
Antibody concentration 0.5 mg/ml
Pack Size: 1 mg
Antibody concentration 1.0 mg/ml
Regulatory
For research purposes only
Guarantee
12 months from date of despatch
Acknowledgements
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Remicade is a trademark of Janssen Biotech Inc. Inflectra is a trademark of Hospira, a Pfizer Company. RENFLEXIS is a trademark of Merck Sharp & Dohme Corp.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
ELISA
This product may be used in an indirect ELISA or as a capture antibody in an Infliximab bridging ELISA together with HRP-conjugated HCA213 or HCA215 as the detection reagent.
Protocol: PK bridging ELISA to measure free drug.

Description Product Code Applications Pack Size List Price Your Price Quantity
Mouse anti V5-Tag:Biotin MCA1360B C E WB 0.1 mg loader
List Price Your Price
loader
Description Mouse anti V5-Tag:Biotin
Mouse anti V5-Tag:HRP MCA1360P E WB 0.1 mg loader
List Price Your Price
loader
Description Mouse anti V5-Tag:HRP
Mouse anti Strep-Tag Classic:HRP MCA2489P E WB 75 µl loader
List Price Your Price
loader
Description Mouse anti Strep-Tag Classic:HRP

Description Product Code Applications Pack Size List Price Your Price Quantity
Hispec Assay Diluent BUF049A E IY 50 ml
List Price Your Price
Description Hispec Assay Diluent
Human anti Infliximab HCA213 E 0.1 mg
List Price Your Price
Description Human anti Infliximab
Human anti Infliximab HCA214 E 0.1 mg
List Price Your Price
Description Human anti Infliximab
Human anti Infliximab HCA215 E 0.1 mg
List Price Your Price
Description Human anti Infliximab
Human anti Infliximab HCA216 E 0.1 mg
List Price Your Price
Description Human anti Infliximab
Mouse anti Human IgG (Fc) CH2 Domain:HRP MCA647P C* E 0.2 mg loader
List Price Your Price
loader
Description Mouse anti Human IgG (Fc) CH2 Domain:HRP
Recombinant Human TNF Alpha PHP051 E FN WB 50 µg
List Price Your Price
Description Recombinant Human TNF Alpha

Synonyms
Remicade
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.

HCA212

148420 148811 156411 166405

HCA212G

163856 1709

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

View more products with Infliximab specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

Please note