Infliximab antibody | AbD17837

100% Secure

Human anti Infliximab

Anti-infliximab antibody is a recombinant, neutralizing anti-idiotypic antibody in monovalent Fab format; it is ideal for bioanalytical assay development for infliximab and biosimilars. It is recommended as capture antibody in PK bridging ELISA format with HCA213/HCA213P to measure free drug.

Product Type
Monoclonal Antibody
HuCAL Fab monovalent
Product Code Applications Pack Size List Price Quantity
0.1 mg loader

1 mg loader

Product Details

Product Form
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
The monovalent intrinsic affinity of this antibody was measured as KD=3.2 nM by real time, label-free molecular interaction analysis on immobilized infliximab.
Approx. Protein Concentrations
Pack Size: 0.1 mg
Antibody concentration 0.5 mg/ml
Pack Size: 1 mg
Antibody concentration 1.0 mg/ml

Storage Information

Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
12 months from date of despatch

More Information

Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Remicade is a registered trademark of Janssen Biotech Inc. Inflectra is a registered trademark of Hospira, a Pfizer Company. RENFLEXIS is a trademark of Merck Sharp & Dohme Corp.
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
For research purposes only

Applications of Infliximab antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
This product may be used in an indirect ELISA or as a capture antibody in an Infliximab bridging ELISA together with HRP-conjugated HCA213 or HCA215 as the detection reagent.
Protocol: PK bridging ELISA to measure free drug

Secondary Antibodies Available

Description Product Code Applications Pack Size List Price Quantity
Mouse anti V5-Tag:Alk. Phos. MCA1360A E WB 0.1 mg loader
Mouse anti V5-Tag:Biotin MCA1360B C E WB 0.1 mg loader
Mouse anti V5-Tag:HRP MCA1360P E WB 0.1 mg loader
Mouse anti Strep-Tag Classic:HRP MCA2489P E WB 75 µl loader

Useful Reagents Available

Description Product Code Applications Pack Size List Price Quantity
Hispec Assay Diluent BUF049A E IY 50 ml
Human anti Infliximab HCA213 E 0.1 mg loader
Human anti Infliximab HCA214 E 0.1 mg loader
Human anti Infliximab HCA215 E 0.1 mg loader
Human anti Infliximab HCA216 E 0.1 mg loader
Mouse anti Human IgG (Fc) CH2 Domain:HRP MCA647P C* E 0.2 mg loader
Recombinant Human TNF Alpha PHP051 E FN WB 50 µg loader

Fluorescent Spectraviewer

Watch the Tool Tutorial Video ▸

How to Use the Spectraviewer?

Watch the Tool Tutorial Video ▸

  • Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
  • Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
  • Select the lasers and filters you wish to include
  • Select combined or multi-laser view to visualize the spectra