Infliximab antibody | AbD17837
To confirm antibody specificity, a microtiter plate was coated overnight with various antigens at a concentration of 5μg/ml. After washing and blocking with PBST+5% BSA, detection was performed using HCA212 at 2μg/ml, followed by Mouse anti Strep-tag classic:HRP (MCA2489P) in HISPEC Assay Diluent (BUF049A) and QuantaBlu Fluorogenic Peroxidase Substrate.
A microtiter plate was coated overnight with Human IgG1/kappa, Human IgG1/lambda or infliximab at a concentration of 5μg/ml. After washing and blocking with PBST+5% BSA, detection was performed using HCA212 titrated to the given concentrations in PBST+10% Human serum, followed by Mouse Anti-Strep-tag classic:HRP (MCA2489P) in HISPEC Assay Diluent (BUF049A) and QuantaBlu Fluorogenic Peroxidase Substrate.
To assess antibody sensitivity, a microtiter plate was coated overnight with HCA212 at 5μg/ml. After washing and blocking with PBST+5% BSA, infliximab was added at the given concentrations. Detection was performed using Mouse Anti-Human IgG (Fc) CH2 domain:HRP (MCA647P) in HISPEC Assay Diluent (BUF049A) and QuantaBlu Fluorogenic Peroxidase Substrate.
To assess the ability of HCA212 to inhibit the binding of infliximab to its target molecule, a microtiter plate was coated overnight with TNFα at a concentration of 1.0µg/ml. After washing and blocking with PBST+5% BSA, a pre-incubated mixture of HCA212 titrated into a constant amount of infliximab (IFX, 0.3μg/ml) was added. Free infliximab, still capable of binding to the plate, was detected using Mouse Anti-Human IgG (Fc) CH2 domain:HRP (MCA647P).
A microtiter plate was coated overnight with HCA212 at a concentration of 1μg/ml. After washing and blocking with PBST+5% BSA, infliximab spiked in 10% Human serum was added at the given concentrations. Detection was performed using HRP-conjugated HCA213 at 2µg/ml in HISPEC Assay Diluent (BUF049A) and QuantaBlu Fluorogenic Peroxidase Substrate.
A microtiter plate was coated overnight with HCA212 at a concentration of 5μg/ml. After washing and blocking with PBST+5% BSA, infliximab spiked in 10% Human serum was added at the given concentrations. Detection was performed using HRP-conjugated HCA215 at 2µg/ml in HISPEC Assay Diluent (BUF049A) and QuantaBlu Fluorogenic Peroxidase Substrate.
Human anti Infliximab
- Product Type
- Monoclonal Antibody
- Clone
- AbD17837
- Isotype
- HuCAL Fab monovalent
- Specificity
- Infliximab
Antibody Quality and Performance Guarantee
| Human Anti-Infliximab, clone AbD17837, is an anti-idiotypic antibody that specifically recognizes the infliximab monoclonal antibody and inhibits the binding of infliximab to its target. It can be used in bioanalytical assays to measure the levels of infliximab and biosimilar products, such as Inflectra and Renflexis, in patient samples. Infliximab (branded as Remicade) is a chimeric monoclonal antibody drug (IgG1/kappa) that has been approved for treatment of psoriasis, Crohn's disease, ankylosing spondylitis, psoriatic arthritis, rheumatoid arthritis, and ulcerative colitis. Infliximab is directed against Tumour Necrosis Factor Alpha (TNFα) and acts by blocking the binding of this cytokine to its receptors. Infliximab also induces apoptosis of TNFα expressing T-lymphocytes. View a summary of all Anti-Infliximab Antibodies. |
|
- Product Form
- HCA212G: A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
- HCA212: A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
- Preparation
- StrepTactin affinity chromatography
- Source
- E.coli
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Infliximab
- Affinity
- The monovalent intrinsic affinity of this antibody is KD = 3.2 nM as measured by real time, label-free molecular interaction analysis on immobilized infliximab.
- Approx. Protein Concentrations
- HCA212G: Antibody concentration 1.0 mg/ml
- HCA212: Antibody concentration 0.5 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Remicade is a trademark of Janssen Biotech Inc. Inflectra is a trademark of Hospira, a Pfizer Company. RENFLEXIS is a trademark of Merck Sharp & Dohme Corp. - Licensed Use
- For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
| Application Name | Verified | Min Dilution | Max Dilution |
|---|---|---|---|
| ELISA |  |
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
This antibody contains Strep-tag and will react with streptavidin. - ELISA
- This product may be used in an indirect ELISA or as a capture antibody in an Infliximab bridging ELISA together with HRP-conjugated HCA213 or HCA215 as the detection reagent.
Protocol: PK bridging ELISA to measure free drug.
| Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
|---|---|---|---|---|---|---|---|
| Mouse anti V5-Tag:Biotin | MCA1360B | C E WB | 0.1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti V5-Tag:Biotin | ||||||
| Mouse anti V5-Tag:HRP | MCA1360P | E WB | 0.1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti V5-Tag:HRP | ||||||
| Mouse anti Strep-Tag Classic:HRP | MCA2489P | E WB | 75 µl |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti Strep-Tag Classic:HRP | ||||||
| Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
|---|---|---|---|---|---|---|---|
| Hispec Assay Diluent | BUF049A | E IY | 50 ml | Log in | |||
| List Price | Your Price | ||||||
| Log in | |||||||
| Description | Hispec Assay Diluent | ||||||
| Human anti Infliximab | HCA213 | E | 0.1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Human anti Infliximab | ||||||
| Human anti Infliximab | HCA214 | E | 0.1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Human anti Infliximab | ||||||
| Human anti Infliximab | HCA215 | E | 0.1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Human anti Infliximab | ||||||
| Human anti Infliximab | HCA216 | E | 0.1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Human anti Infliximab | ||||||
| Mouse anti Human IgG (Fc) CH2 Domain:HRP | MCA647P | C * E | 0.2 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti Human IgG (Fc) CH2 Domain:HRP | ||||||
| Recombinant Human TNF Alpha | PHP051 | E FN WB | 50 µg | Log in | |||
| List Price | Your Price | ||||||
| Log in | |||||||
| Description | Recombinant Human TNF Alpha | ||||||
- Synonyms
- Remicade
View more products with INFLIXIMAB specificity
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
Always be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up