Infliximab Antibody | AbD17837

Infliximab Antibody | AbD17837 gallery image 1

HCA212 Specificity ELISA

To confirm antibody specificity, a microtiter plate was coated overnight with various antigens at a concentration of 5µg/ml. After washing and blocking with PBST+5% BSA, detection was performed using HCA212 at 2µg/ml, followed by Mouse anti Strep-tag classic:HRP (MCA2489P) in HISPEC assay diluent (BUF049A) and QuantaBlu fluorogenic peroxidase substrate

Infliximab Antibody | AbD17837 gallery image 2

HCA212 Specificity Titration ELISA

A microtiter plate was coated overnight with Human IgG1/kappa, Human IgG1/lambda or Infliximab at a concentration of 5µg/ml. After washing and blocking with PBST+5% BSA, detection was performed using HCA212 titrated to the given concentrations in PBST+10% human serum, followed by Mouse anti Strep-tag classic:HRP (MCA2489P) in HISPEC assay diluent (BUF049A) and QuantaBlu fluorogenic peroxidase substrate

Infliximab Antibody | AbD17837 gallery image 3

HCA212 Sensitivity ELISA

To assess antibody sensitivity, a microtiter plate was coated overnight with HCA212 at 5µg/ml. After washing and blocking with PBST+5% BSA, Infliximab was added at the given concentrations. Detection was performed using Mouse anti Human IgG (Fc) CH2 domain:HRP (MCA647P) in HISPEC assay diluent (BUF049A) and QuantaBlu fluorogenic peroxidase substrate

Infliximab Antibody | AbD17837 gallery image 4

Infliximab Inhibition ELISA

To assess the ability of HCA212 to inhibit the binding of Infliximab to its target molecule, a microtiter plate was coated overnight with TNFα at a concentration of 1.0µg/ml. After washing and blocking with PBST+5% BSA, a pre-incubated mixture of HCA212 titrated into a constant amount of Infliximab (IFX, 0.3µg/ml) was added. Free Infliximab, still capable of binding to the plate, was detected using Mouse anti Human IgG (Fc) CH2 domain:HRP (MCA647P)

Infliximab Antibody | AbD17837 gallery image 5

Infliximab Bridging ELISA for Pharmacokinetic (PK) Assay Development

A microtiter plate was coated overnight with HCA212 at a concentration of 1µg/ml. After washing and blocking with PBST+5% BSA, Infliximab spiked in 10% human serum was added at the given concentrations. Detection was performed using HRP-conjugated HCA213 at 2µg/ml in HISPEC assay diluent (BUF049A) and QuantaBlu fluorogenic peroxidase substrate

Infliximab Antibody | AbD17837 gallery image 6

Infliximab Bridging ELISA for Pharmacokinetic (PK) Assay Development

A microtiter plate was coated overnight with HCA212 at a concentration of 5µg/ml. After washing and blocking with PBST+5% BSA, Infliximab spiked in 10% Human serum was added at the given concentrations. Detection was performed using HRP-conjugated HCA215 at 2µg/ml in HISPEC assay diluent (BUF049A) and QuantaBlu fluorogenic peroxidase substrate

  • Infliximab Antibody | AbD17837 thumbnail image 1
  • Infliximab Antibody | AbD17837 thumbnail image 2
  • Infliximab Antibody | AbD17837 thumbnail image 3
  • Infliximab Antibody | AbD17837 thumbnail image 4
  • Infliximab Antibody | AbD17837 thumbnail image 5
  • Infliximab Antibody | AbD17837 thumbnail image 6
  • Human anti Infliximab
(Rated 0.0 out of 5 based on 0 customer reviews)
    Anti-infliximab antibody is a recombinant, neutralizing anti-idiotypic antibody in monovalent Fab format; it is ideal for bioanalytical assay development for infliximab and biosimilars. It is recommended as capture antibody in PK bridging ELISA format with HCA213/HCA213P to measure free drug.
    • Product Type
      Monoclonal Antibody
    • Clone
    • Isotype
      HuCAL Fab monovalent
    1 Formats Available
      Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
      HCA212Edatasheet pdfdatasheet pdf0.1 mg
      Secondary Antibodies
      Negative Isotype Controls
      Useful Reagents
      Positive Controls
      Histology Controls
      More Images
      • Human anti Infliximab, clone AbD17837, is an anti-idiotypic antibody that specifically recognizes the infliximab monoclonal antibody and inhibits the binding of infliximab to its target. It can be used in bioanalytical assays to measure the levels of infliximab and biosimilar products in patient samples.

        Infliximab (branded as Remicade®) is a chimeric monoclonal antibody drug (IgG1/kappa) that has been approved for treatment of psoriasis, Crohn's disease, ankylosing spondylitis, psoriatic arthritis, rheumatoid arthritis, and ulcerative colitis.

        Infliximab is directed against Tumour Necrosis Factor Alpha (TNFα) and acts by blocking the binding of this cytokine to its receptors. Infliximab also induces apoptosis of TNFα expressing T-lymphocytes.

        View a summary of all anti-infliximab antibodies.
      • Intended Use
      • Product Form
        A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
      • Reconstitution
      • Preparation
        StrepTactin affinity chromatography
      • Preservative Stabilisers
        0.01% Thiomersal
      • Immunogen
      • Purity
      • Affinity
        The monovalent intrinsic affinity of this antibody was measured as KD=3.2 nM by real time, label-free molecular interaction analysis on immobilized infliximab.
      • Approx. Protein Concentrations
        Antibody concentration 0.5 mg/ml.
      • Reagents In The Kit
      • Preparing The Antibody
      • Test Principle
      • Buffer Solution
        Phosphate buffered saline.
      • Storage
        Store at +4oC or at -20oC if preferred.
        Storage in frost-free freezers is not recommended.
        This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      • Shelf Life
        12 months from date of despatch.
      • Acknowledgements
        Sold under license of U.S. Patents 6,300,064, 6,696,248, 6,708,484, 6,753,136, European Patent 0,859,841 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
        Remicade® is a registered trademark of Janssen Biotech Inc.
      • Licensed Use
        For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
      • Regulatory
        For research purposes only
      • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

      • Application NameYesNoMin DilutionMax Dilution

      • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
      • Technical Advice
        Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
      • Recommended Protocol
      • ELISA
        This product may be used in an indirect ELISA or as a capture antibody in an Infliximab bridging ELISA together with HRP-conjugated HCA213 or HCA215 as the detection reagent.
        Protocol: PK bridging ELISA to measure free drug
      • Immunohistology
      • Histology Positive Control Tissue
      • Immunofluorescence
      • Western Blotting
      • Instructions For Use

      Additional Infliximab Antibody Formats

      Formats Clone Applications Sizes available
      Infliximab Antibody : Purified AbD17837 E 0.1 mg
      • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

      Recommended Secondary Antibody

        DescriptionProduct CodePack SizeApplicationsList PriceQuantity
        Mouse anti V5-Tag:Alk. Phos.MCA1360A0.1 mgE, WB
        Mouse anti V5-Tag:BiotinMCA1360B0.1 mgC, E, WB
        Mouse anti V5-Tag:HRPMCA1360P0.1 mgE, WB
        Mouse anti Strep-Tag Classic:HRPMCA2489P75 µlE, WB

        Recommended Negative Isotype Control

          Useful Reagents

            DescriptionProduct CodePack SizeApplicationsList PriceQuantity
            Mouse anti Human IgG (Fc) CH2 Domain:HRPMCA647P0.2 mgC *, E
            Human anti InfliximabHCA2130.1 mgE
            Human anti InfliximabHCA2140.1 mgE
            Human anti InfliximabHCA2150.1 mgE
            Human anti InfliximabHCA2160.1 mgE
            Hispec Assay DiluentBUF049A50 mlIY
            Recombinant Human TNF AlphaPHP05150 µgE, FN, WB

            Recommended Positive Controls

              Histology Controls

                Write your review

                You may also be interested in...