Ustekinumab Antibody | 17829

Ustekinumab Antibody | 17829 gallery image 1

ELISA demonstrating the specificity of HCA208 using various antigens as coating reagents (A: Human serum, B: human IgG1/kappa from myeloma plasma, C: Rituximab, D: Bevacizumab, E: Adalimumab, F: Alemtuzumab, G: Infliximab, H: Ustekinumab).
Antigens were coated at 5 µg/mL on a microtiter plate overnight. After washing and blocking with 5% BSA, the anti-Ustekinumab antibody AbD17829 (20µL from a 2µg/mL solution) was added followed by Mouse anti-V5-tag:HRP (MCA1360P)in HiSPEC buffer (BUF049). Detection was performed using QuantaBlu™ fluorogenic peroxidase substrate

Ustekinumab Antibody | 17829 gallery image 2

Inhibition of Ustekinumab binding to IL-23 by HCA208.
IL-23 (1.0 µg/mL) was used as the coating antigen followed by a pre-incubated mixture of the anti-idiotypic antibody HCA208 titrated into a constant amount of Ustekinumab (0.3 µg/mL). Free Ustekinumab still capable of binding to the plate was detected using Mouse anti Human IgG(Fc):HRP (MCA647P). Data is shown as the mean of three measurements

Ustekinumab Antibody | 17829 gallery image 3

HCA208 PK assay - bridging format.
Anti-Ustekinumab antibody HCA208 (AbD17829) was coated at 1.0 µg/mL on a microtiter plate overnight. After washing and blocking with 5% BSA in PBST, Ustekinumab spiked into 10% human serum was added. Detection was performed by adding HRP conjugated anti-Ustekinumab antibody (HCA210), 2 µg/mL in HiSPEC buffer (BUF049), plus QuantaBlu™ fluorogenic peroxidase substrate. Data is shown as the mean of three measurements

  • Ustekinumab Antibody | 17829 thumbnail image 1
  • Ustekinumab Antibody | 17829 thumbnail image 2
  • Ustekinumab Antibody | 17829 thumbnail image 3
  • Human anti Ustekinumab
(Rated 0.0 out of 5 based on 0 customer reviews)
    Anti-ustekinumab antibody is a recombinant, neutralizing anti-idiotypic antibody in monovalent Fab format; it is ideal for bioanalytical assay development for ustekinumab and biosimilars. This antibody is recommended as capture antibody in PK bridging ELISA format with HCA210/HCA210P for detection.
    • Product Type
      Monoclonal Antibody
    • Clone
    • Isotype
      HuCAL Fab monovalent
    1 Formats Available
      Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
      HCA208Edatasheet pdfdatasheet pdf0.1 mg
      Secondary Antibodies
      Negative Isotype Controls
      Useful Reagents
      Positive Controls
      Histology Controls
      More Images
      • Ustekinumab (branded as Stelara®) is a fully human monoclonal antibody drug (IgG1/kappa) that has been approved for treatment of moderate to severe psoriasis. Ustekinumab is also being investigated for the treatment of psoriatic arthritis, for multiple sclerosis and sarcoidosis. Studies indicate that it may also have potential for treating severe Crohns disease.
        Ustekinumab is directed against the p40 subunit of interleukin-12 and interleukin-23 and acts by blocking the binding of these two cytokines to, and preventing activation of, T-lymphocytes.

        Human anti Ustekinumab antibody, clone 17829 is an anti-idiotypic antibody that specifically recognises the Ustekinumab monoclonal antibody and inhibits the binding of Ustekinumab to its target. It can be used to measure Ustekinumab levels in serum from patients.

        The monovalent intrinsic affinity of this antibody was measured as KD=2.8 nM by real time, label-free molecular interaction analysis using an Attana A200 instrument on immobilized Ustekinumab.

        For our full range of Ustekinumab antibodies, please visit our Ustekinumab website.
      • Intended Use
      • Product Form
        A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
      • Reconstitution
      • Preparation
        StrepTactin affinity chromatography
      • Preservative Stabilisers
        0.01% Thiomersal
      • Immunogen
      • Purity
      • Approx. Protein Concentrations
        Antibody concentration 0.5 mg/ml.
      • Reagents In The Kit
      • Preparing The Antibody
      • Test Principle
      • Buffer Solution
        Phosphate buffered saline.
      • Storage
        Store at +4oC or at -20oC if preferred.
        Storage in frost-free freezers is not recommended.
        This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      • Shelf Life
        12 months from date of despatch.
      • Acknowledgements
        Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
      • Licensed Use
        For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
      • Regulatory
        For research purposes only
      • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

      • Application NameYesNoMin DilutionMax Dilution

      • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
      • Technical Advice
        Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
      • Recommended Protocol
      • ELISA
        This product may be used as a capture antibody in a sandwich ELISA together with HCA210P as the detection reagent.

        Protocol: PK bridging ELISA to measure free drug
      • Immunohistology
      • Histology Positive Control Tissue
      • Immunofluorescence
      • Western Blotting
      • Instructions For Use

      Additional Ustekinumab Antibody Formats

      Formats Clone Applications Sizes available
      Ustekinumab Antibody : Purified 17829 E 0.1 mg
      • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

      Recommended Secondary Antibody

        DescriptionProduct CodePack SizeApplicationsList PriceQuantity
        Mouse anti V5-Tag:Alk. Phos.MCA1360A0.1 mgE, WB
        Mouse anti V5-Tag:BiotinMCA1360B0.1 mgC, E, WB
        Mouse anti V5-Tag:HRPMCA1360P0.1 mgE, WB
        Mouse anti Human IgG (Fc) CH2 Domain:HRPMCA647P0.2 mgC*, E
        Mouse anti Strep-Tag Classic:HRPMCA2489P75 µlE, WB

        Recommended Negative Isotype Control

          Useful Reagents

            Recommended Positive Controls

              Histology Controls

                Write your review

                You may also be interested in...