Human Immunodeficiency Virus 1 gp41 antibody

Goat anti Human Immunodeficiency Virus 1 gp41

Product Type
Polyclonal Antibody
Isotype
Polyclonal IgG
Specificity
Human Immunodeficiency Virus 1 gp41

Product Code Applications Pack Size List Price Your Price Qty
AHP2207
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E WB 1 mg
List Price Your Price

Goat anti Human innunodeficiency virus gp41 antibody recognises gp41 from human immunodeficiency virus 1. After cleavage of gp160 into gp120 and gp41, gp41 remains non-covalently bound to gp120 and aids the virus in entering the cell.

Target Species
Viral
Product Form
Purified IgG - liquid
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
<0.1% Sodium Azide (NaN3)
Immunogen
Synthetic peptide CH3CO-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2.
Purity
>98%
Approx. Protein Concentrations
IgG concentration 1.0 mg/ml
Regulatory
For research purposes only
Guarantee
12 months from date of despatch

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA 1/500 1/10,000
Western Blotting 1/500 1/10,000
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using the appropriate negative/positive controls.

Description Product Code Applications Pack Size List Price Your Price Quantity
Rabbit anti Goat IgG (Fc):FITC STAR122F F 1 mg loader
List Price Your Price
loader
Description Rabbit anti Goat IgG (Fc):FITC
Rabbit anti Goat IgG (Fc):HRP STAR122P C E WB 1 mg loader
List Price Your Price
loader
Description Rabbit anti Goat IgG (Fc):HRP

Synonyms
HIV-1
RRID
AB_10851403
UniProt
Q70626
GO Terms
GO:0006915 apoptosis
GO:0016021 integral to membrane
GO:0005198 structural molecule activity
GO:0019031 viral envelope
GO:0019059 initiation of viral infection
GO:0020002 host cell plasma membrane
GO:0030260 entry into host cell
GO:0030683 evasion by virus of host immune response
GO:0044175 host cell endosome membrane
GO:0055036 virion membrane

AHP2207

156454 200114

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.