IL-21 antibody

Goat anti Human Interleukin-21 (N-Terminal)
- Product Type
- Polyclonal Antibody
- Isotype
- Polyclonal IgG
- Specificity
- IL-21
- Region
- (N-TERMINAL)
Goat anti Human Interleukin-21 antibody recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a , a 155 amino acid pro-cytokine, reduced to 133 anino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence atthe C-terminus (UniProt: Q9HBE4). Goat anti Human interleukin-21 antibody recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms. IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway. Goat anti Human Interleukin-21 antibody is suitable for use in immunocytochemistry on human spleen or tonsil cells. |
- Target Species
- Human
- Product Form
- Purified IgG - liquid
- Antiserum Preparation
- Antiserum to human IL-21 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.1% Sodium Azide (NaN3)
0.1% Bovine Serum Albumin - Immunogen
- Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminal region of human IL-21.
- Approx. Protein Concentrations
- IgG concentration 1.0 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | ![]() |
1/50000 | |
Immunocytochemistry | ![]() |
||
Immunohistology - Paraffin 1 | ![]() |
- 1IL-21 antibody requires antigen retrieval using heat treatment prior to staining of paraffin sections.
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Rabbit anti Goat IgG (Fc):FITC | STAR122F | F | 1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Rabbit anti Goat IgG (Fc):FITC | ||||||
Rabbit anti Goat IgG (Fc):HRP | STAR122P | C E WB | 1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Rabbit anti Goat IgG (Fc):HRP |
- RRID
- AB_2125267
- UniProt
- Q9HBE4
- Entrez Gene
- IL21
- GO Terms
- GO:0007165 signal transduction
- GO:0005125 cytokine activity
- GO:0005134 interleukin-2 receptor binding
- GO:0005615 extracellular space
- GO:0006955 immune response
- GO:0032740 positive regulation of interleukin-17 production
- GO:0034105 positive regulation of tissue remodeling
- GO:0042102 positive regulation of T cell proliferation
- GO:0045078 positive regulation of interferon-gamma biosynthetic process
- View More GO Terms
- GO:0048469 cell maturation
- GO:0050729 positive regulation of inflammatory response
AHP1817

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Human ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up