IL-21 antibody

100% Secure

Goat anti Human Interleukin-21 (N-Terminal)

Product Type
Polyclonal Antibody
Polyclonal IgG
Product Code Applications Pack Size List Price Quantity
50 µg loader

Goat anti Human Interleukin-21 antibody recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a , a 155 amino acid pro-cytokine, reduced to 133 anino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence atthe C-terminus (UniProt: Q9HBE4). Goat anti Human interleukin-21 antibody recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms.

IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway.

Goat anti Human Interleukin-21 antibody is suitable for use in immunocytochemistry on human spleen or tonsil cells.

Product Details

Target Species
Product Form
Purified IgG - liquid
Antiserum Preparation
Antiserum to human IL-21 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.1% Sodium Azide (NaN3)
0.1% Bovine Serum Albumin
Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminal region of human IL-21.
Approx. Protein Concentrations
IgG concentration 1.0 mg/ml

Storage Information

Store at -20oC only.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
18 months from date of despatch.

More Information

Entrez Gene
GO Terms
GO:0007165 signal transduction
GO:0005125 cytokine activity
GO:0005134 interleukin-2 receptor binding
GO:0005615 extracellular space
GO:0006955 immune response
GO:0032740 positive regulation of interleukin-17 production
GO:0034105 positive regulation of tissue remodeling
GO:0042102 positive regulation of T cell proliferation
GO:0045078 positive regulation of interferon-gamma biosynthetic process
GO:0048469 cell maturation
GO:0050729 positive regulation of inflammatory response
For research purposes only

Applications of IL-21 antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA 1/50000
Immunohistology - Paraffin 1
  1. 1IL-21 antibody requires antigen retrieval using heat treatment prior to staining of paraffin sections.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.

Secondary Antibodies Available

Description Product Code Applications Pack Size List Price Quantity
Rabbit anti Goat IgG (Fc):FITC STAR122F F 1 mg loader
Rabbit anti Goat IgG (Fc):HRP STAR122P C E WB 1 mg loader