CD62L antibody
Rabbit anti CD62L
- Product Type
- PrecisionAb Polyclonal
- Isotype
- Polyclonal IgG
- Format
- Purified
- Specificity
- CD62L
- Target Species
- Human
- Western Blotting
- Anti CD62L detects a band of approximately 42 kDa in HepG2 cell lysates.
- Species Cross-Reactivity
-
Target Species Cross Reactivity Mouse - N.B. Antibody reactivity and working conditions may vary between species.
- Product Form
- Purified IgG - liquid.
- Preparation
- Rabbit polyclonal antibody purified by affinity chromatography.
- Buffer Solution
- Phosphate buffered saline.
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
2% Sucrose. - Immunogen
- Synthetic peptide - FSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
- Regulatory
- For research purposes only.
- Guarantee
- 12 months from date of despatch.
- Acknowledgements
- PrecisionAb is a trademark of Bio-Rad Laboratories.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
Western Blotting | 1/1000 |
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Goat anti Rabbit IgG (H/L):HRP | STAR208P | WB | 2 ml | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Goat anti Rabbit IgG (H/L):HRP |
- UniProt
- P14151
- Entrez Gene
- SELL
- GO Terms
- GO:0007596 blood coagulation
- GO:0007155 cell adhesion
- GO:0005887 integral to plasma membrane
- GO:0005529 sugar binding
- GO:0008201 heparin binding
- GO:0043208 glycosphingolipid binding
- GO:0050776 regulation of immune response
- GO:0050900 leukocyte migration
VPA00599
160801If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Human ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up