Browsing Modes for Business Users

CD284 antibody

Goat anti Human CD284 (N-Terminal)

Product Type
Polyclonal Antibody
Isotype
Polyclonal IgG
Specificity
CD284
Region
(N-TERMINAL)

Product Code Applications Pack Size List Price Your Price Qty
AHP1822
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
P * WB 0.1 mg
List Price Your Price

Goat anti Human CD284 antibody recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206).

Goat anti Human CD284 antibody recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling.

Goat anti Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells.

Target Species
Human
Species Cross-Reactivity
Target SpeciesCross Reactivity
Mouse
Rat
N.B. Antibody reactivity and working conditions may vary between species.
Product Form
Purified IgG - liquid
Antiserum Preparation
Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.1% Sodium Azide (NaN3)
0.1% Bovine Serum Albumin
Immunogen
Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
Approx. Protein Concentrations
IgG concentration 1.0mg/ml
Regulatory
For research purposes only
Guarantee
12 months from date of despatch

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Immunohistology - Paraffin 1 1/100 1/300
Western Blotting 1/500
  1. 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Histology Positive Control Tissue
Spleen or tonsil

Description Product Code Applications Pack Size List Price Your Price Quantity
Rabbit anti Goat IgG (Fc):FITC STAR122F F 1 mg loader
List Price Your Price
loader
Description Rabbit anti Goat IgG (Fc):FITC
Rabbit anti Goat IgG (Fc):HRP STAR122P C E WB 1 mg loader
List Price Your Price
loader
Description Rabbit anti Goat IgG (Fc):HRP

Description Product Code Applications Pack Size List Price Your Price Quantity
Antigen Retrieval Buffer, pH8.0 BUF025A P 500 ml
List Price Your Price
Description Antigen Retrieval Buffer, pH8.0

Synonyms
TLR4
RRID
AB_2256158
UniProt
O00206
Entrez Gene
TLR4

AHP1822

146995 165131

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

View more products with CD284 specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

View all Anti-Human Products
Please note