CD284 antibody

100% Secure

Goat anti Human CD284 (N-Terminal)

Product Type
Polyclonal Antibody
Polyclonal IgG
Product Code Applications Pack Size List Price Quantity
0.1 mg loader

Goat anti Human CD284 antibody recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206).

Goat anti Human CD284 antibody recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling.

Goat anti Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells.

Product Details

Target Species
Species Cross-Reactivity
Target SpeciesCross Reactivity
N.B. Antibody reactivity and working conditions may vary between species.
Product Form
Purified IgG - liquid
Antiserum Preparation
Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.1% Sodium Azide (NaN3)
0.1% Bovine Serum Albumin
Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
Approx. Protein Concentrations
IgG concentration 1.0mg/ml

Storage Information

Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
18 months from date of despatch.

More Information

O00206 Related reagents
Entrez Gene
TLR4 Related reagents
For research purposes only

Applications of CD284 antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Immunohistology - Paraffin 1 1/100 1/300
Western Blotting 1/500
  1. 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Histology Positive Control Tissue
Spleen or tonsil

Secondary Antibodies Available

Description Product Code Applications Pack Size List Price Quantity
Rabbit anti Goat IgG (Fc):FITC STAR122F F 1 mg loader
Rabbit anti Goat IgG (Fc):HRP STAR122P C E WB 1 mg loader

Useful Reagents Available

Description Product Code Applications Pack Size List Price Quantity
Antigen Retrieval Buffer, pH8.0 BUF025A P 500 ml
Antigen Retrieval Buffer, pH8.0 BUF025C P 50 ml