CD284 antibody
Goat anti Human CD284 (N-Terminal)
- Product Type
- Polyclonal Antibody
- Isotype
- Polyclonal IgG
- Specificity
- CD284
- Region
- (N-TERMINAL)
Goat anti Human CD284 antibody recognizes the human Toll-like receptor 4, also known as CD284, hToll
or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206). Goat anti Human CD284 antibody recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. Goat anti Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells. |
- Target Species
- Human
- Species Cross-Reactivity
-
Target Species Cross Reactivity Mouse Rat - N.B. Antibody reactivity and working conditions may vary between species.
- Product Form
- Purified IgG - liquid
- Antiserum Preparation
- Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.1% Sodium Azide (NaN3)
0.1% Bovine Serum Albumin - Immunogen
- Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
- Approx. Protein Concentrations
- IgG concentration 1.0mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
Immunohistology - Paraffin 1 | 1/100 | 1/300 | |
Western Blotting | 1/500 |
- 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.
- Histology Positive Control Tissue
- Spleen or tonsil
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Rabbit anti Goat IgG (Fc):FITC | STAR122F | F | 1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Rabbit anti Goat IgG (Fc):FITC | ||||||
Rabbit anti Goat IgG (Fc):HRP | STAR122P | C E WB | 1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Rabbit anti Goat IgG (Fc):HRP |
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Antigen Retrieval Buffer, pH8.0 | BUF025A | P | 500 ml | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Antigen Retrieval Buffer, pH8.0 |
References for CD284 antibody
-
ElSayed, M.H. et al. (2023) Betanin improves motor function and alleviates experimental Parkinsonism via downregulation of TLR4/MyD88/NF-κB pathway: Molecular docking and biological investigations.
Biomed Pharmacother. 164: 114917.
- Synonyms
- TLR4
- RRID
- AB_2256158
- UniProt
- O00206
- Entrez Gene
- TLR4
AHP1822
146995 165131If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Human ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up