CD284 antibody
Goat anti Human CD284 (N-Terminal)
- Product Type
- Polyclonal Antibody
- Isotype
- Polyclonal IgG
- Specificity
- CD284
- Region
- (N-TERMINAL)
Antibody Quality and Performance Guarantee
| Goat anti Human CD284 antibody recognizes the human Toll-like receptor 4, also known as CD284, hToll
or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206). Goat anti Human CD284 antibody recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. Goat anti Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells. |
- Target Species
- Human
- Species Cross-Reactivity
-
Target Species Cross Reactivity Mouse Rat - N.B. Antibody reactivity and working conditions may vary between species.
- Product Form
- Purified IgG - liquid
- Antiserum Preparation
- Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.1% Sodium Azide (NaN3)
0.1% Bovine Serum Albumin - Immunogen
- Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
- Approx. Protein Concentrations
- IgG concentration 1.0mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
| Application Name | Verified | Min Dilution | Max Dilution |
|---|---|---|---|
| Immunohistology - Paraffin 1 |  |
1/100 | 1/300 |
| Western Blotting | |
1/500 |
- 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- Histology Positive Control Tissue
- Spleen or tonsil
| Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
|---|---|---|---|---|---|---|---|
| Rabbit anti Goat IgG (Fc):FITC | STAR122F | F | 1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Rabbit anti Goat IgG (Fc):FITC | ||||||
| Rabbit anti Goat IgG (Fc):HRP | STAR122P | C E WB | 1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Rabbit anti Goat IgG (Fc):HRP | ||||||
| Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
|---|---|---|---|---|---|---|---|
| Antigen Retrieval Buffer, pH8.0 | BUF025A | P | 500 ml | Log in | |||
| List Price | Your Price | ||||||
| Log in | |||||||
| Description | Antigen Retrieval Buffer, pH8.0 | ||||||
References for CD284 antibody
-
ElSayed, M.H. et al. (2023) Betanin improves motor function and alleviates experimental Parkinsonism via downregulation of TLR4/MyD88/NF-κB pathway: Molecular docking and biological investigations.
Biomed Pharmacother. 164: 114917.
- Synonyms
- TLR4
- RRID
- AB_2256158
- UniProt
- O00206
- Entrez Gene
- TLR4
AHP1822
146995
165131
If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
View more products with CD284 specificity
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Human ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up