Ustekinumab antibody | AbD17829

100% Secure


Human anti Ustekinumab

Anti-ustekinumab antibody is a recombinant, neutralizing anti-idiotypic antibody in monovalent Fab format; it is ideal for bioanalytical assay development for ustekinumab and biosimilars. This antibody is recommended as capture antibody in PK bridging ELISA format with HCA210/HCA210P for detection.

Product Type
Monoclonal Antibody
Clone
AbD17829
Isotype
HuCAL Fab monovalent
Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
HCA208 E 0.1 mg
Human Anti-Ustekinumab Antibody, clone AbD17829 is a paratope specific, anti-idiotypic antibody that specifically recognizes the monoclonal antibody drug ustekinumab and inhibits binding to its target. The antibody can be used to measure the level of free ustekinumab and biosimilar products in bioanalytical and patient monitoring assays.

A pair of anti-ustekinumab antibodies can be used to develop a pharmacokinetic (PK) bridging assay to measure free drug. This antibody, in monovalent Fab format, is recommended as a capture antibody, paired with an HRP conjugated Anti-Ustekinumab Antibody in full immunoglobulin format, clone AbD17827_hIgG1 (HCA210) as the detection antibody.

Ustekinumab (Stelara) is a fully human monoclonal antibody drug (IgG1/kappa) that has been approved in US, Canada, and Europe for the treatment of plaque psoriasis and psoriatic arthritis. The FDA approved the medication for the treatment of moderate-severe Crohn's disease in 2016. The drug blocks interleukin IL-12 and IL-23 by binding with high affinity and specificity to the p40 subunit, preventing the binding of these two cytokines to T-lymphocytes, and thereby disrupting the proinflammatory pathway.

View a summary of all anti-ustekinumab antibodies

Product Details

Product Form
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
Preparation
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
Immunogen
Ustekinumab
Affinity
The monovalent intrinsic affinity of AbD17829 was measured as KD = 2.8 nM by real time, label free molecular interaction analysis on immobilized ustekinumab
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml

Storage Information

Storage
Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.

More Information

Acknowledgements
Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
Regulatory
For research purposes only

Applications of Ustekinumab antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
ELISA
This product may be used as a capture antibody in a sandwich ELISA together with HCA210P as the detection reagent.

Protocol: PK bridging ELISA to measure free drug

Secondary Antibodies Available

Description Product Code Pack Size Applications List Price Quantity
Mouse anti V5-Tag:Alk. Phos. MCA1360A 0.1 mg E WB
Mouse anti V5-Tag:Biotin MCA1360B 0.1 mg C E WB
Mouse anti V5-Tag:HRP MCA1360P 0.1 mg E WB
Mouse anti Strep-Tag Classic:HRP MCA2489P 75 µl E WB
Mouse anti Human IgG (Fc) CH2 Domain:HRP MCA647P 0.2 mg C* E