Ustekinumab antibody | AbD17829

100% Secure

Human anti Ustekinumab

Anti-ustekinumab antibody is a recombinant, neutralizing anti-idiotypic antibody in monovalent Fab format; it is ideal for bioanalytical assay development for ustekinumab and biosimilars. This antibody is recommended as capture antibody in PK bridging ELISA format with HCA210/HCA210P for detection.

Product Type
Monoclonal Antibody
HuCAL Fab monovalent
Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
HCA208 E 0.1 mg
Ustekinumab (branded as Stelara®) is a fully human monoclonal antibody drug (IgG1/kappa) that has been approved for treatment of moderate to severe psoriasis. Ustekinumab is also being investigated for the treatment of psoriatic arthritis, for multiple sclerosis and sarcoidosis. Studies indicate that it may also have potential for treating severe Crohns disease.
Ustekinumab is directed against the p40 subunit of interleukin-12 and interleukin-23 and acts by blocking the binding of these two cytokines to, and preventing activation of, T-lymphocytes.

Human anti Ustekinumab antibody, clone AbD17829 is an anti-idiotypic antibody that specifically recognises the Ustekinumab monoclonal antibody and inhibits the binding of Ustekinumab to its target. It can be used to measure Ustekinumab levels in serum from patients.

The monovalent intrinsic affinity of this antibody was measured as KD=2.8 nM by real time, label-free molecular interaction analysis using an Attana A200 instrument on immobilized Ustekinumab.

For our full range of Ustekinumab antibodies, please visit our Ustekinumab website.

Product Details

Product Form
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml

Storage Information

Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life
12 months from date of despatch

More Information

Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
For research purposes only

Applications of Ustekinumab antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
This product may be used as a capture antibody in a sandwich ELISA together with HCA210P as the detection reagent.

Protocol: PK bridging ELISA to measure free drug

Secondary Antibodies Available

Description Product Code Pack Size Applications List Price Quantity
Mouse anti V5-Tag:Alk. Phos. MCA1360A 0.1 mg E WB
Mouse anti V5-Tag:Biotin MCA1360B 0.1 mg C E WB
Mouse anti V5-Tag:HRP MCA1360P 0.1 mg E WB
Mouse anti Strep-Tag Classic:HRP MCA2489P 75 µl E WB
Mouse anti Human IgG (Fc) CH2 Domain:HRP MCA647P 0.2 mg C* E