Ustekinumab antibody | AbD17829



Filter by Application:
E ResetHuman anti Ustekinumab
- Product Type
- Monoclonal Antibody
- Clone
- AbD17829
- Isotype
- HuCAL Fab monovalent
- Specificity
- Ustekinumab
Quick Links:
Human Anti-Ustekinumab Antibody, clone AbD17829 is a paratope specific, anti-idiotypic antibody that specifically recognizes the monoclonal antibody drug ustekinumab and inhibits binding to its target. The antibody can be used to measure the level of free ustekinumab and biosimilar products in bioanalytical and patient monitoring assays. A pair of anti-ustekinumab antibodies can be used to develop a pharmacokinetic (PK) bridging assay to measure free drug. This antibody, in monovalent Fab format, is recommended as a capture antibody, paired with an HRP conjugated Anti-Ustekinumab Antibody in full immunoglobulin format, clone AbD17827_hIgG1 (HCA210) as the detection antibody. Ustekinumab (Stelara) is a fully human monoclonal antibody drug (IgG1/kappa) that has been approved in US, Canada, and Europe for the treatment of plaque psoriasis and psoriatic arthritis. The FDA approved the medication for the treatment of moderate-severe Crohn's disease in 2016. The drug blocks interleukin IL-12 and IL-23 by binding with high affinity and specificity to the p40 subunit, preventing the binding of these two cytokines to T-lymphocytes, and thereby disrupting the proinflammatory pathway. View a summary of all anti-ustekinumab antibodies |
- Product Form
- A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
- Preparation
- StrepTactin affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.01% Thiomersal
- Immunogen
- Ustekinumab
- Affinity
- The monovalent intrinsic affinity of AbD17829 was measured as KD = 2.8 nM by real time, label free molecular interaction analysis on immobilized ustekinumab
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | ![]() |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
- ELISA
- This product may be used as a capture antibody in a sandwich ELISA together with HCA210P as the detection reagent.
Protocol: PK bridging ELISA to measure free drug
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Mouse anti V5-Tag:Alk. Phos. | MCA1360A | E WB | 0.1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Mouse anti V5-Tag:Alk. Phos. | ||||||
Mouse anti V5-Tag:Biotin | MCA1360B | C E WB | 0.1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Mouse anti V5-Tag:Biotin | ||||||
Mouse anti V5-Tag:HRP | MCA1360P | E WB | 0.1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Mouse anti V5-Tag:HRP | ||||||
Mouse anti Strep-Tag Classic:HRP | MCA2489P | E WB | 75 µl |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Mouse anti Strep-Tag Classic:HRP | ||||||
Mouse anti Human IgG (Fc) CH2 Domain:HRP | MCA647P | C* E | 0.2 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Mouse anti Human IgG (Fc) CH2 Domain:HRP |
- Synonyms
- Stelara®
- Licensed Use
- For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
Always be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up