IL-21 Antibody

IL-21 Antibody gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

  • IL-21 Antibody thumbnail image 1
  • Goat anti Human Interleukin-21 (N-Terminal)
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Polyclonal Antibody
  • Isotype
    Polyclonal IgG
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    AHP1817E, IC, P *datasheet pdfdatasheet pdf50 µg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • Goat anti Human Interleukin-21 antibody recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a , a 155 amino acid pro-cytokine, reduced to 133 anino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence atthe C-terminus (UniProt: Q9HBE4). Goat anti Human interleukin-21 antibody recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms.

      IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway.

      Goat anti Human Interleukin-21 antibody is suitable for use in immunocytochemistry on human spleen or tonsil cells.
    • Intended Use
    • Target Species
    • Product Form
      Purified IgG - liquid
    • Reconstitution
    • Preparation
    • Antiserum Preparation
      Antiserum to human IL-21 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
    • Preservative Stabilisers
      0.1% Sodium Azide (NaN3)
      0.1% Bovine Serum Albumin
    • Immunogen
      Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminal region of human IL-21.
    • Purity
    • Approx. Protein Concentrations
      IgG concentration 1.0 mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
    • Storage
      Store at -20oC only.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      18 months from date of despatch.
    • GO Terms
      positive regulation of tissue remodeling
      positive regulation of inflammatory response
      positive regulation of interferon-gamma biosynthetic process
      immune response
      extracellular space
      positive regulation of interleukin-17 production
      signal transduction
      positive regulation of T cell proliferation
      cytokine activity
      cell maturation
      interleukin-2 receptor binding
    • UniProt
    • Entrez Gene
    • Acknowledgements
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Immunohistology - Paraffin(1)
      IL-21 antibody requires antigen retrieval using heat treatment prior to staining of paraffin sections.

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
    • Recommended Protocol
    • ELISA
      AHP1817 may be used for the detection of human IL-21 in combination with AHP1816
    • Immunohistology
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional IL-21 Antibody Formats

    Formats Applications Sizes available
    IL-21 Antibody : Purified E, IC, P * 50 µg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Rabbit anti Goat IgG (Fc):FITCSTAR122F1 mgF
      Rabbit anti Goat IgG (Fc):HRPSTAR122P1 mgC, E, WB

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              Write your review

              • View more products with "IL-21" specificity.

              You may also be interested in...