CD284 Antibody

CD284 Antibody gallery image 1

Paraffin embedded human tonsil stained with Goat anti human CD284 (AHP1822)

CD284 Antibody gallery image 2

Paraffin embedded mouse spleen stained with Goat anti human CD284 (AHP1822)

  • CD284 Antibody thumbnail image 1
  • CD284 Antibody thumbnail image 2
  • Goat anti Human CD284 (N-Terminal)
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Polyclonal Antibody
  • Isotype
    Polyclonal IgG
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    AHP1822P *, WBdatasheet pdfdatasheet pdf0.1 mg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • Goat anti Human CD284 antibody recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206).

      Goat anti Human CD284 antibody recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling.

      Goat anti Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells.
    • Intended Use
    • Target Species
    • Species Cross-Reactivity
      Target SpeciesCross Reactivity
      N.B. Antibody reactivity and working conditions may vary between species.
    • Product Form
      Purified IgG - liquid
    • Reconstitution
    • Preparation
    • Antiserum Preparation
      Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
    • Preservative Stabilisers
      0.1% Sodium Azide (NaN3)
      0.1% Bovine Serum Albumin
    • Immunogen
      Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
    • Purity
    • Approx. Protein Concentrations
      IgG concentration 1.0mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      18 months from date of despatch.
    • UniProt
    • Entrez Gene
    • Acknowledgements
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Western Blotting1/1000
      Immunohistology - Paraffin(1)1/1001/300
      This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
    • Recommended Protocol
    • ELISA
    • Immunohistology
    • Histology Positive Control Tissue
      Spleen or tonsil
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional CD284 Antibody Formats

    Formats Applications Sizes available
    CD284 Antibody : Purified P *, WB 0.1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Rabbit anti Goat IgG (Fc):FITCSTAR122F1 mgF
      Rabbit anti Goat IgG (Fc):HRPSTAR122P1 mgC, E, WB

      Recommended Negative Isotype Control

        Useful Reagents

          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Antigen Retrieval Buffer, pH8.0BUF025C50 mlP
          Antigen Retrieval Buffer, pH8.0BUF025A500 mlP

          Recommended Positive Controls

            Histology Controls

              Spleen or tonsil

              Write your review

              You may also be interested in...