IL-22 antibody | AbD36295
Human anti Bovine Interleukin-22
- Product Type
- Monoclonal Antibody
- Clone
- AbD36295
- Isotype
- HuCAL Fab bivalent
- Specificity
- IL-22
Human anti Bovine Interleukin-22, clone AbD36295 recognizes bovine interleukin-22 (IL-22). IL-22 is a T and NK cell cytokine, a member of IL-10 cytokine family and is expressed by mitogen activated bovine peripheral blood γδ T cells. IL-22 is rapidly produced by splenic cells and can be produced by Th17 cells. IL-22 takes part in regulating the immune responses of adaptive and innate immune systems. Human anti Bovine Interleukin-22 has been successfully used to analyze IL-22 expression in PBMC from M. bovis. – infected cattle. Bovine tuberculin induced IL-22 and IL-17A production in M. bovis. infected cattle was observed in both CD4+ T cells and γδ T cell populations (Steinbach et al. 2016). |
- Target Species
- Bovine
- Product Form
- A bivalent human recombinant Fab selected from the HuCAL phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
- Preparation
- StrepTactin affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Fc-fusion protein containing the amino acid sequence 34-190 from bovine interleukin-22
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
- ELISA Matched Pair(s)
- ELISA Matched Pair-Capture Antibody: HCA362
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
- ELISA
- This product may be used as a detection reagent in a sandwich ELISA together with HCA362 as the capture reagent.
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Rat anti DYKDDDDK Tag:HRP | MCA4764P | E P WB | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Rat anti DYKDDDDK Tag:HRP |
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Recombinant Bovine Interleukin-22 | PBP042 | E | 25 µl | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Recombinant Bovine Interleukin-22 |
Antibody Characterization Reference
-
Steinbach, S. et al. (2016) CD4+ and γδ T Cells are the main Producers of IL-22 and IL-17A in Lymphocytes from Mycobacterium bovis-infected Cattle.
Sci Rep. 6: 29990.
- UniProt
- F1SH68
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
HCA363
158516If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Bovine ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up