IL-22 antibody | AbD36295

100% Secure


Human anti Bovine Interleukin-22

Product Type
Monoclonal Antibody
Clone
AbD36295
Isotype
HuCAL Fab bivalent
Product Code Applications Pack Size List Price Quantity
HCA363
Datasheet
E
SDS
0.1 mg loader

Human anti Bovine Interleukin-22, clone AbD36295 recognizes bovine interleukin-22 (IL-22).

IL-22 is a T and NK cell cytokine, a member of IL-10 cytokine family and is expressed by mitogen activated bovine peripheral blood γδ T cells. IL-22 is rapidly produced by splenic cells and can be produced by Th17 cells. IL-22 takes part in regulating the immune responses of adaptive and innate immune systems.

Human anti Bovine Interleukin-22, clone AbD36295 has been successfully used to analyze IL-22 expression in PBMC from M. bovis. – infected cattle. Bovine tuberculin induced IL-22 and IL-17A production in M. bovis. infected cattle was observed in both CD4+ T cells and γδ T cell populations (Steinbach et al. 2016).

Product Details

Target Species
Bovine
Product Form
A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
Preparation
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
Immunogen
Fc-fusion protein containing the amino acid sequence 34-190 from bovine interleukin-22
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml

Storage Information

Storage
This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Guarantee
12 months from date of despatch

More Information

UniProt
F1SH68
Acknowledgements
Sold under license of U.S. Patents 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad.
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
Regulatory
For research purposes only

Applications of IL-22 antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
ELISA
This product may be used as a detection reagent in a sandwich ELISA together with HCA362 as the capture reagent.

Useful Reagents Available

Description Product Code Applications Pack Size List Price Quantity
Rat anti DYKDDDDK Tag:HRP MCA4764P E P WB 0.1 mg loader

Product Specific References

Antibody Characterization Reference

  1. Steinbach, S. et al. (2016) CD4+ and γδ T Cells are the main Producers of IL-22 and IL-17A in Lymphocytes from Mycobacterium bovis-infected Cattle.
    Sci Rep. 6: 29990.

Fluorescent Spectraviewer

Watch the Tool Tutorial Video ▸

How to Use the Spectraviewer

Watch the Tool Tutorial Video ▸
  • Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
  • Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
  • Select the lasers and filters you wish to include
  • Select combined or multi-laser view to visualize the spectra