IL-22 antibody | AbD36295

Human anti Bovine Interleukin-22

Product Type
Monoclonal Antibody
Clone
AbD36295
Isotype
HuCAL Fab bivalent
Specificity
IL-22

Product Code Applications Pack Size List Price Your Price Qty
HCA363
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E 0.1 mg loader
List Price Your Price
loader

Human anti Bovine Interleukin-22, clone AbD36295 recognizes bovine interleukin-22 (IL-22).

IL-22 is a T and NK cell cytokine, a member of IL-10 cytokine family and is expressed by mitogen activated bovine peripheral blood γδ T cells. IL-22 is rapidly produced by splenic cells and can be produced by Th17 cells. IL-22 takes part in regulating the immune responses of adaptive and innate immune systems.

Human anti Bovine Interleukin-22 has been successfully used to analyze IL-22 expression in PBMC from M. bovis. – infected cattle. Bovine tuberculin induced IL-22 and IL-17A production in M. bovis. infected cattle was observed in both CD4+ T cells and γδ T cell populations (Steinbach et al. 2016).

Target Species
Bovine
Product Form
A bivalent human recombinant Fab selected from the HuCAL phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
Preparation
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
Immunogen
Fc-fusion protein containing the amino acid sequence 34-190 from bovine interleukin-22
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml
ELISA Matched Pair(s)
ELISA Matched Pair-Capture Antibody: HCA362
Regulatory
For research purposes only
Guarantee
12 months from date of despatch
Acknowledgements
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
ELISA
This product may be used as a detection reagent in a sandwich ELISA together with HCA362 as the capture reagent.

Description Product Code Applications Pack Size List Price Your Price Quantity
Rat anti DYKDDDDK Tag:HRP MCA4764P E P WB 0.1 mg loader
List Price Your Price
loader
Description Rat anti DYKDDDDK Tag:HRP

Description Product Code Applications Pack Size List Price Your Price Quantity
Recombinant Bovine Interleukin-22 PBP042 E 25 µl loader
List Price Your Price
loader
Description Recombinant Bovine Interleukin-22

Antibody Characterization Reference

  1. Steinbach, S. et al. (2016) CD4+ and γδ T Cells are the main Producers of IL-22 and IL-17A in Lymphocytes from Mycobacterium bovis-infected Cattle.
    Sci Rep. 6: 29990. Sci Rep. 6: 29990.

UniProt
F1SH68
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.

HCA363

158516

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

View more products with IL-22 specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

View all Anti-Bovine Products