IL-22 antibody | AbD36295

Filter by Application:
E ResetHuman anti Bovine Interleukin-22
- Product Type
- Monoclonal Antibody
- Clone
- AbD36295
- Isotype
- HuCAL Fab bivalent
- Specificity
- IL-22
Human anti Bovine Interleukin-22, clone AbD36295 recognizes bovine interleukin-22 (IL-22). IL-22 is a T and NK cell cytokine, a member of IL-10 cytokine family and is expressed by mitogen activated bovine peripheral blood γδ T cells. IL-22 is rapidly produced by splenic cells and can be produced by Th17 cells. IL-22 takes part in regulating the immune responses of adaptive and innate immune systems. Human anti Bovine Interleukin-22 has been successfully used to analyze IL-22 expression in PBMC from M. bovis. – infected cattle. Bovine tuberculin induced IL-22 and IL-17A production in M. bovis. infected cattle was observed in both CD4+ T cells and γδ T cell populations (Steinbach et al. 2016). |
- Target Species
- Bovine
- Product Form
- A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
- Preparation
- StrepTactin affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.01% Thiomersal
- Immunogen
- Fc-fusion protein containing the amino acid sequence 34-190 from bovine interleukin-22
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
- ELISA Matched Pair(s)
-
ELISA Matched Pair-Capture Antibody:
HCA362
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | ![]() |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
- ELISA
- This product may be used as a detection reagent in a sandwich ELISA together with HCA362 as the capture reagent.
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Rat anti DYKDDDDK Tag:HRP | MCA4764P | E P WB | 0.1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Rat anti DYKDDDDK Tag:HRP |
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Recombinant Bovine Interleukin-22 | PBP042 | E | 25 µl |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Recombinant Bovine Interleukin-22 |
Antibody Characterization Reference
-
Steinbach, S. et al. (2016) CD4+ and γδ T Cells are the main Producers of IL-22 and IL-17A in Lymphocytes from Mycobacterium bovis-infected Cattle.
Sci Rep. 6: 29990. Sci Rep. 6: 29990.
- UniProt
- F1SH68
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Bovine ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up