IL-2 antibody | AbD22297
Human anti bovine interleukin-2, clone AbD22297, has been successfully used for the detection and measurement of native and recombinant bovine IL-2 in ELISA where it acts as the detection antibody in a sensitive assay for bovine IL-2 determination. Bio-Rad recommend clone AbD21766 (HCA267) for intracellular flow cytometry.
Product Details
- Target Species
- Bovine
- Product Form
- A bivalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). Conjugated to horseradish peroxidase (HRP) - liquid.
- Product Form
- A bivalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
- Preparation
- Metal chelate affinity chromatography
- Preparation
- Metal chelate affinity chromatography
- Buffer Solution
- Phosphate buffered saline.
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.01% Thiomersal
- Preservative Stabilisers
- 0.01% Thiomersal
- Immunogen
- Fc-fusion protein containing the amino acid sequence 21-155 from bovine interleukin-2
- Affinity
- The monovalent intrinsic affinity of this antibody was measured as KD=0.3 nM by real time, label-free molecular interaction analysis on recombinant bovine IL-2.
- Approx. Protein Concentrations
- Antibody concentration 0.1 mg/ml
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
Storage Information
- Storage
- Store at -70oC.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. - Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Guarantee
- 12 months from date of despatch
- Guarantee
- 12 months from date of despatch
More Information
- UniProt
- P05016
- Entrez Gene
- IL2
- GO Terms
- GO:0005125 cytokine activity
- GO:0005615 extracellular space
- GO:0006955 immune response
- GO:0008083 growth factor activity
- Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
- Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
- Regulatory
- For research purposes only
Applications of IL-2 antibody
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | |||
ELISpot | |||
Flow Cytometry | |||
ELISA | |||
ELISpot | |||
Flow Cytometry |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
- ELISA
- This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.
- ELISA
- This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.
Secondary Antibodies Available
Description | Product Code | Applications | Pack Size | List Price | Quantity |
---|---|---|---|---|---|
Mouse anti V5-Tag:HRP | MCA1360P | E WB | 0.1 mg |
![]() |
Useful Reagents Available
Description | Product Code | Applications | Pack Size | List Price | Quantity |
---|---|---|---|---|---|
Human anti Bovine Interleukin-2 | HCA267 | E ES F | 0.1 mg |
![]() |
|
Human anti Bovine Interleukin-2:Alexa Fluor® 647 | HCA267A647 | F | 100 Tests/1ml |
![]() |
|
Human anti Bovine Interleukin-2 | HCA268 | E ES | 0.1 mg |
![]() |
|
Streptavidin:HRP | STAR5B | C E P WB | 1 mg |
![]() |
|
Human anti Bovine Interleukin-2 | HCA267 | E ES F | 0.1 mg |
![]() |
|
Streptavidin:HRP | STAR5B | C E P WB | 1 mg |
![]() |
Product Specific References
Further Reading
-
Rhodes, S.G. et al. (2014) Use of antigen-specific interleukin-2 to differentiate between cattle vaccinated with Mycobacterium bovis BCG and cattle infected with M. bovis.
Clin Vaccine Immunol. 21:39-45.
Fluorescent Spectraviewer
Watch the Tool Tutorial Video ▸
How to Use the Spectraviewer?
Watch the Tool Tutorial Video ▸
- Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
- Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
- Select the lasers and filters you wish to include
- Select combined or multi-laser view to visualize the spectra