IL-2 antibody | AbD22297

Filter by Application:
E ResetHuman anti Bovine Interleukin-2
- Product Type
- Monoclonal Antibody
- Clone
- AbD22297
- Isotype
- HuCAL Fab bivalent
- Specificity
- IL-2
Human anti Bovine Interleukin-2, clone AbD22297 recognizes bovine interleukin-2 (IL-2), also known as T-cell growth factor (TCGF). Bovine IL-2 is a 155 amino acid secreted cytokine produced by T-cells following antigenic or mitogenic stimulation. It plays a crucial role in T-cell proliferation and immune regulation. Human anti bovine interleukin-2, clone AbD22297, has been successfully used for the detection and measurement of native and recombinant bovine IL-2 in ELISA where it acts as the detection antibody in a sensitive assay for bovine IL-2 determination. Bio-Rad recommend clone AbD21766 (HCA267) for intracellular flow cytometry. |
- Target Species
- Bovine
- Product Form
- A bivalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
- Preparation
- Metal chelate affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.01% Thiomersal
- Immunogen
- Fc-fusion protein containing the amino acid sequence 21-155 from bovine interleukin-2
- Affinity
- The monovalent intrinsic affinity of this antibody was measured as KD=0.3 nM by real time, label-free molecular interaction analysis on recombinant bovine IL-2.
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | ![]() |
||
ELISpot | ![]() |
||
Flow Cytometry |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
- ELISA
- This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Mouse anti V5-Tag:HRP | MCA1360P | E WB | 0.1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Mouse anti V5-Tag:HRP |
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Human anti Bovine Interleukin-2 | HCA267 | E ES F | 0.1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Human anti Bovine Interleukin-2 | ||||||
Streptavidin:HRP | STAR5B | C E P WB | 1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Streptavidin:HRP |
Further Reading
-
Rhodes, S.G. et al. (2014) Use of antigen-specific interleukin-2 to differentiate between cattle vaccinated with Mycobacterium bovis BCG and cattle infected with M. bovis.
Clin Vaccine Immunol. 21:39-45.
- UniProt
- P05016
- Entrez Gene
- IL2
- GO Terms
- GO:0005125 cytokine activity
- GO:0005615 extracellular space
- GO:0006955 immune response
- GO:0008083 growth factor activity
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Bovine ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up