IL-2 antibody | AbD22297

100% Secure

Human anti Bovine Interleukin-2:HRP

Human anti Bovine Interleukin-2

Product Type
Monoclonal Antibody
HuCAL Fab bivalent
Product Code Applications Pack Size List Price Quantity
0.1 mg loader

0.1 mg loader

Human anti Bovine Interleukin-2, clone AbD22297 recognizes bovine interleukin-2 (IL-2), also known as T-cell growth factor (TCGF). Bovine IL-2 is a 155 amino acid secreted cytokine produced by T-cells following antigenic or mitogenic stimulation. It plays a crucial role in T-cell proliferation and immune regulation.

Human anti bovine interleukin-2, clone AbD22297, has been successfully used for the detection and measurement of native and recombinant bovine IL-2 in ELISA where it acts as the detection antibody in a sensitive assay for bovine IL-2 determination. Bio-Rad recommend clone AbD21766 (HCA267) for intracellular flow cytometry.

Product Details

Target Species
Product Form
A bivalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). Conjugated to horseradish peroxidase (HRP) - liquid.
Product Form
A bivalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
Metal chelate affinity chromatography
Metal chelate affinity chromatography
Buffer Solution
Phosphate buffered saline.
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
Preservative Stabilisers
0.01% Thiomersal
Fc-fusion protein containing the amino acid sequence 21-155 from bovine interleukin-2
The monovalent intrinsic affinity of this antibody was measured as KD=0.3 nM by real time, label-free molecular interaction analysis on recombinant bovine IL-2.
Approx. Protein Concentrations
Antibody concentration 0.1 mg/ml
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml

Storage Information

Store at -70oC.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody.
Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
12 months from date of despatch
12 months from date of despatch

More Information

Entrez Gene
GO Terms
GO:0005125 cytokine activity
GO:0005615 extracellular space
GO:0006955 immune response
GO:0008083 growth factor activity
Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
For research purposes only

Applications of IL-2 antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Flow Cytometry
Flow Cytometry
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.
This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.

Secondary Antibodies Available

Description Product Code Applications Pack Size List Price Quantity
Mouse anti V5-Tag:HRP MCA1360P E WB 0.1 mg loader

Useful Reagents Available

Description Product Code Applications Pack Size List Price Quantity
Human anti Bovine Interleukin-2 HCA267 E ES F 0.1 mg loader
Human anti Bovine Interleukin-2:Alexa Fluor® 647 HCA267A647 F 100 Tests/1ml loader
Human anti Bovine Interleukin-2 HCA268 E ES 0.1 mg loader
Streptavidin:HRP STAR5B C E P WB 1 mg loader
Human anti Bovine Interleukin-2 HCA267 E ES F 0.1 mg loader
Streptavidin:HRP STAR5B C E P WB 1 mg loader

Product Specific References

Further Reading

  1. Rhodes, S.G. et al. (2014) Use of antigen-specific interleukin-2 to differentiate between cattle vaccinated with Mycobacterium bovis BCG and cattle infected with M. bovis.
    Clin Vaccine Immunol. 21:39-45.

Fluorescent Spectraviewer

Watch the Tool Tutorial Video ▸

How to Use the Spectraviewer?

Watch the Tool Tutorial Video ▸

  • Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
  • Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
  • Select the lasers and filters you wish to include
  • Select combined or multi-laser view to visualize the spectra