Browsing Modes for Business Users

IL-2 antibody | AbD22297

Human anti Bovine Interleukin-2

Product Type
Monoclonal Antibody
Clone
AbD22297
Isotype
HuCAL Fab bivalent
Specificity
IL-2

Product Code Applications Pack Size List Price Your Price Qty
HCA268
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E ES 0.1 mg loader
List Price Your Price
loader

Human anti Bovine Interleukin-2, clone AbD22297 recognizes bovine interleukin-2 (IL-2), also known as T-cell growth factor (TCGF). Bovine IL-2 is a 155 amino acid secreted cytokine produced by T-cells following antigenic or mitogenic stimulation. It plays a crucial role in T-cell proliferation and immune regulation.

Human anti bovine interleukin-2, clone AbD22297, has been successfully used for the detection and measurement of native and recombinant bovine IL-2 in ELISA where it acts as the detection antibody in a sensitive assay for bovine IL-2 determination. Bio-Rad recommend clone AbD21766 (HCA267) for intracellular flow cytometry.

Target Species
Bovine
Product Form
A bivalent human recombinant Fab (kappa light chain) selected from the HuCAL phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
Preparation
Metal chelate affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
Immunogen
Fc-fusion protein containing the amino acid sequence 21-155 from bovine interleukin-2
Affinity
The intrinsic affinity of the monovalent form of this antibody is KD=0.3 nM as measured by real time, label-free molecular interaction analysis on recombinant bovine IL-2.
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml
Regulatory
For research purposes only
Guarantee
12 months from date of despatch
Acknowledgements
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
ELISpot
Flow Cytometry
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
ELISA
This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.

Description Product Code Applications Pack Size List Price Your Price Quantity
Mouse anti V5-Tag:HRP MCA1360P E WB 0.1 mg loader
List Price Your Price
loader
Description Mouse anti V5-Tag:HRP

Description Product Code Applications Pack Size List Price Your Price Quantity
Human anti Bovine Interleukin-2 HCA267 E ES F * 0.1 mg
List Price Your Price
Description Human anti Bovine Interleukin-2
Streptavidin:HRP STAR5B C E P WB 1 mg
List Price Your Price
Description Streptavidin:HRP

Further Reading

  1. Rhodes, S.G. et al. (2014) Use of antigen-specific interleukin-2 to differentiate between cattle vaccinated with Mycobacterium bovis BCG and cattle infected with M. bovis.
    Clin Vaccine Immunol. 21:39-45.

UniProt
P05016
Entrez Gene
IL2
GO Terms
GO:0005125 cytokine activity
GO:0005615 extracellular space
GO:0006955 immune response
GO:0008083 growth factor activity
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.

HCA268

1604

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

View more products with IL-2 specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

View all Anti-Bovine Products
Please note