HuCAL Fab-FSx2 Negative Control antibody | AbD08968
HuCAL Fab-FSx2 Negative Control
- Product Type
- Negative/Isotype Control
- Clone
- AbD08968
- Isotype
- HuCAL Fab monovalent
- Specificity
- HuCAL Fab-FSx2 Negative Control
- Target Species
- Negative Control
- Product Form
- A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL GOLD phage display library. Expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
- Preparation
- StreptTactin affinity chromatography
- Source
- E.coli
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Green fluorescent protein
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
This antibody contains Strep-tag and will react with streptavidin.
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Mouse anti Strep-Tag Classic:HRP | MCA2489P | E WB | 75 µl | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Mouse anti Strep-Tag Classic:HRP |
- RRID
- AB_1935511
- Licensed Use
- For in vitro. research purposes only, unless otherwise specified in writing by Bio-Rad.
HCA101A
0414 164432If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Negative Control ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up