HuCAL Fab-A-FSx2 Negative Control Antibody | AbD08972

HuCAL Fab-A-FSx2 Negative Control Antibody | AbD08972 gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

  • HuCAL Fab-A-FSx2 Negative Control Antibody | AbD08972 thumbnail image 1
  • HuCAL Fab-A-FSx2 Negative Control
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Negative/Isotype Control
  • Clone
  • Isotype
    HuCAL Fab bivalent
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA107C, E, F, P, WBdatasheet pdfdatasheet pdf0.1 mg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • HuCAL Fab-A-FSx2 negative control, clone AbD08972 is a recombinant antibody with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It is therefore recommended as a negative control reagent when using other HuCAL antibodies of the same format. It is recommended that this reagent is used at the same concentration as the test reagent.
    • Intended Use
    • Target Species
      Negative Control
    • Product Form
      A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
    • Reconstitution
    • Preparation
      StrepTactin affinity chromatography
    • Preservative Stabilisers
      0.01% Thiomersal
    • Immunogen
      Green fluorescent protein
    • Purity
    • Approx. Protein Concentrations
      Total protein concentration 0.5 mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      12 months from date of despatch
    • Acknowledgements
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Flow Cytometry
      Immunohistology - Frozen
      Immunohistology - Paraffin
      Western Blotting

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • ELISA
    • Immunohistology
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional HuCAL Fab-A-FSx2 Negative Control Antibody Formats

    Formats Clone Applications Sizes available
    HuCAL Fab-A-FSx2 Negative Control Antibody : Purified AbD08972 C, E, F, P, WB 0.1 mg
    • Copyright © 2018 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Mouse anti Strep-Tag Classic:HRPMCA2489P75 µlE, WB

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              Write your review

              You may also be interested in...