HuCAL Fab-FSx2 Negative Control antibody | AbD08968

HuCAL Fab-FSx2 Negative Control

Product Type
Negative/Isotype Control
HuCAL Fab monovalent
HuCAL Fab-FSx2 Negative Control

Product Code Applications Pack Size List Price Your Price Qty
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E 50 µg loader
List Price Your Price
Search for Batch Specific Datasheets

HuCAL Fab-FSx2 negative control, clone AbD08968 is a recombinant Fab antibody fragment in the format Fab-FSx2 with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It has been tested by ELISA for specificity to GFP, but has not been tested in other applications. It is suggested as a negative control reagent when using other HuCAL antibodies of the same Fab format.

It is recommended that this reagent is used at the same concentration as the test reagent.

Target Species
Negative Control
Product Form
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL GOLD phage display library. Expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
StreptTactin affinity chromatography.
Buffer Solution
Phosphate buffered saline.
Preservative Stabilisers
0.01% Thiomersal.
Green fluorescent protein
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml.
For research purposes only.
12 months from date of despatch.
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See for details.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.

Description Product Code Applications Pack Size List Price Your Price Quantity
Mouse anti Strep-Tag Classic:HRP MCA2489P E WB 75 µl loader
List Price Your Price
Description Mouse anti Strep-Tag Classic:HRP

Licensed Use
For in vitro. research purposes only, unless otherwise specified in writing by Bio-Rad.
Request a different product with this specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

View all Negative Control Products