HuCAL Fab-FSx2 Negative Control antibody | AbD08968

100% Secure

HuCAL Fab-FSx2 Negative Control

Product Type
Negative/Isotype Control
HuCAL Fab monovalent
Product Code Applications Pack Size List Price Quantity
50 µg loader

HuCAL Fab-FSx2 negative control, clone AbD08968 is a recombinant Fab antibody fragment in the format Fab-FSx2 with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It has been tested by ELISA for specificity to GFP, but has not been tested in other applications. It is suggested as a negative control reagent when using other HuCAL antibodies of the same Fab format.

It is recommended that this reagent is used at the same concentration as the test reagent.

Product Details

Target Species
Negative Control
Product Form
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL® GOLD phage display library. Expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
StreptTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
Green fluorescent protein
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml

Storage Information

Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
12 months from date of despatch

More Information

Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
For research purposes only

Applications of HuCAL Fab-FSx2 Negative Control antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual

Secondary Antibodies Available

Description Product Code Applications Pack Size List Price Quantity
Mouse anti Strep-Tag Classic:HRP MCA2489P E WB 75 µl loader