HuCAL Fab-dHLX-MSx2 Negative Control antibody | AbD08969

100% Secure

HuCAL Fab-dHLX-MSx2 Negative Control

Product Type
Negative/Isotype Control
HuCAL Fab bivalent
Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
HCA102 C E F P WB 0.1 mg
HuCAL Fab-dHLX-MSx2 negative control, clone AbD08969 is a recombinant antibody with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It is therefore recommended as a negative control reagent when using other HuCAL antibodies of the same format. It is recommended that this reagent is used at the same concentration as the test reagent.

Product Details

Target Species
Negative Control
Product Form
A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied lyophilized.
Reconstitute with 1.0 ml distilled water
StrepTactin affinity chromatography.
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
1% Bovine Serum Albumin
Green fluorescent protein.
Approx. Protein Concentrations
Total protein concentration 0.1 mg/ml

Storage Information

Prior to reconstitution store at +4oC.
After reconstitution store at -20oC.
Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life
12 months from date of reconstitution.

More Information

Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
For research purposes only

Applications of HuCAL Fab-dHLX-MSx2 Negative Control antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Flow Cytometry
Immunohistology - Frozen
Immunohistology - Paraffin
Western Blotting
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual

Secondary Antibodies Available

Description Product Code Pack Size Applications List Price Quantity
Mouse anti c-Myc MCA2200 1 mg C E F* P WB*
Mouse anti c-Myc:Alk.Phos. MCA2200A 0.1 mg C E P WB*
Mouse anti c-Myc:Alexa Fluor® 488 MCA2200A488 100 Tests/1ml F*
Mouse anti c-Myc:Alexa Fluor® 647 MCA2200A647 100 Tests/1ml F*
Mouse anti c-Myc:FITC MCA2200F 0.1 mg F*
Mouse anti c-Myc:HRP MCA2200P 0.1 mg C E P WB*
Mouse anti c-Myc:RPE MCA2200PE 100 Tests WB
Mouse anti Strep-Tag Classic:HRP MCA2489P 75 µl E WB