HuCAL Fab-dHLX-MSx2 Negative Control antibody | AbD08969
No associated image currently available
HuCAL Fab-dHLX-MSx2 Negative Control
- Product Type
- Negative/Isotype Control
- Clone
- AbD08969
- Isotype
- HuCAL Fab bivalent
- Specificity
- HuCAL Fab-dHLX-MSx2 Negative Control
Antibody Quality and Performance Guarantee
| HuCAL Fab-dHLX-MSx2 negative control, clone AbD08969 is a recombinant Fab antibody fragment in the format Fab-dHLX-MSx2 with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It has been tested by ELISA for specificity to GFP, but has not been tested in other applications. It is suggested as a negative control reagent when using other HuCAL antibodies of the same Fab format. It is recommended that this reagent is used at the same concentration as the test reagent. |
|
- Target Species
- Negative Control
- Product Form
- A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL GOLD phage display library. Expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
- Preparation
- StrepTactin affinity chromatography
- Source
- E.coli
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Green fluorescent protein.
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
- Licensed Use
- For in vitro. research purposes only, unless otherwise specified in writing by Bio-Rad.
This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
| Application Name | Verified | Min Dilution | Max Dilution |
|---|---|---|---|
| ELISA |  |
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
This antibody contains Strep-tag and will react with streptavidin.
| Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
|---|---|---|---|---|---|---|---|
| Mouse anti c-Myc | MCA2200 | C E F * P WB * | 1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti c-Myc | ||||||
| Mouse anti c-Myc:Alexa Fluor® 488 | MCA2200A488 | F * | 100 Tests/1ml |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti c-Myc:Alexa Fluor® 488 | ||||||
| Mouse anti c-Myc:Alexa Fluor® 647 | MCA2200A647 | F * | 100 Tests/1ml |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti c-Myc:Alexa Fluor® 647 | ||||||
| Mouse anti c-Myc:FITC | MCA2200F | F * | 0.1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti c-Myc:FITC | ||||||
| Mouse anti c-Myc:HRP | MCA2200P | C E P WB * | 0.1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti c-Myc:HRP | ||||||
| Mouse anti Strep-Tag Classic:HRP | MCA2489P | E WB | 75 µl |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Mouse anti Strep-Tag Classic:HRP | ||||||
- RRID
- AB_1898197
HCA102
152425
If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Request a different product with this specificity
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Negative Control ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up