HuCAL Fab-A-FSx2 Negative Control antibody | AbD08972
No associated image currently available
HuCAL Fab-A-FSx2 negative control, clone AbD08972 is a recombinant antibody with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It is therefore recommended as a negative control reagent when using other HuCAL antibodies of the same format. It is recommended that this reagent is used at the same concentration as the test reagent.
Product Details
- Target Species
- Negative Control
- Product Form
- A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
- Preparation
- StrepTactin affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.01% Thiomersal
- Immunogen
- Green fluorescent protein
- Approx. Protein Concentrations
- Total protein concentration 0.5 mg/ml
Storage Information
- Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Shelf Life
- 12 months from date of despatch
More Information
- Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
- Regulatory
- For research purposes only
Applications of HuCAL Fab-A-FSx2 Negative Control antibody
| Application Name | Verified | Min Dilution | Max Dilution |
|---|---|---|---|
| ELISA | |||
| Flow Cytometry | |||
| Immunohistology - Frozen | |||
| Immunohistology - Paraffin | |||
| Western Blotting |
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Copyright © 2018 Bio-Rad Antibodies (formerly AbD Serotec)
Secondary Antibodies Available
| Description | Product Code | Pack Size | Applications | List Price | Quantity |
|---|---|---|---|---|---|
| Mouse anti Strep-Tag Classic:HRP | MCA2489P | 75 µl | E WB |
