HuCAL Fab-A-FSx2 Negative Control antibody | AbD08972

ISO 9001 Quality Assurance Manufacturing | Print

No associated image currently available

HuCAL Fab-A-FSx2 Negative Control

Product Type: Negative/Isotype Control
Clone: AbD08972
Isotype: HuCAL Fab bivalent
Specificity: HuCAL Fab-A-FSx2 Negative Control

Antibody Quality and Performance Guarantee

Unrivaled Technical Support

Product Code Applications Pack Size List Price Your Price Qty

List Price	Your Price
HCA107 Datasheet Datasheet SDS SDS	E	0.1 mg		Log in	Get Quote
	Log in

HuCAL Fab-A-FSx2 negative control, clone AbD08972 is a recombinant Fab antibody fragment in the format Fab-A-FSx2 with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It has been tested by ELISA for specificity to GFP, but has not been tested in other applications. It is suggested as a negative control reagent when using other HuCAL antibodies of the same Fab format.

It is recommended that this reagent is used at the same concentration as the test reagent.

Target Species: Negative Control
Product Form: A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL GOLD phage display library. Expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
Preparation: StrepTactin affinity chromatography
Source: E.coli
Buffer Solution: Phosphate buffered saline
Preservative Stabilisers: 0.09% Sodium Azide (NaN₃)
Immunogen: Green fluorescent protein.
Approx. Protein Concentrations: Antibody concentration 0.5 mg/ml
Regulatory: For research purposes only
Guarantee: 12 months from date of despatch
Acknowledgements: This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

Application Name	Verified	Min Dilution	Max Dilution
ELISA

Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.

Technical Advice: Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.