Aflibercept antibody | AbD38778da
Human anti Aflibercept
- Product Type
- Monoclonal Antibody
- Clone
- AbD38778da
- Isotype
- HuCAL Fab monovalent
- Specificity
- Aflibercept
Human Anti-Aflibercept Antibody, clone AbD38778da is a recombinant antibody that specifically recognizes the fusion protein drug aflibercept as well as the vascular endothelial growth factor receptor 1 (VEGFR1). It does not recognize vascular endothelial growth factor receptor 2 (VEGFR2). It does not inhibit the binding of aflibercept to its target, the vascular endothelial growth factor (VEGF); it binds to both free aflibercept and aflibercept bound to its target VEGF and can be used to measure levels of aflibercept and its biosimilars in bioanalytical assays. A pair of anti-aflibercept antibodies can be used to develop a pharmacokinetic (PK) bridging assay to measure free drug. This antibody, in monovalent Fab format, is recommended as the capture antibody, paired with the Human Anti-Aflibercept Antibody, clone AbD34644ia (HCA386) as the detection antibody. Aflibercept (Eylea, Zaltrap) is a recombinant fusion protein consisting of the extra-cellular domain of human VEGF receptors 1 and 2, fused to the Fc portion of human IgG1. It is used to treat the 'wet' form of age-related macular degeneration (AMD) and impaired vision due to macular oedema. It is also used in the treatment of metastatic colorectal cancer in combination with 5-fluorouracil, leucovorin and irinotecan in patients previously treated with an oxaliplatin-containing chemotherapy. Aflibercept binds to circulating VEGF-A and VEGF-B to inhibit their ability to promote angiogenesis. View a summary of all anti aflibercept antibodies |
- Product Form
- A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) at the C-terminus of the antibody heavy chain. This antibody is supplied as a liquid.
- Preparation
- Metal chelate affinity chromatography
- Source
- E. coli
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Aflibercept
- Affinity
- The intrinsic affinity of the monovalent form of Human anti Aflibercept antibody, clone AbD38778da is KD = 4 nM as measured by real time, label free molecular interaction analysis on immobilized Aflibercept
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Eylea is a trademark of Regeneron/Sanofi.
Zaltrap is a trademark of Regeneron/Bayer Healthcare. - Licensed Use
- For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
This antibody contains a Strep-tag and will react with streptavidin. - ELISA
- Human anti Aflibercept antibody, clone AbD38778da can be used in an indirect ELISA. It can also be used as the capture antibody for aflibercept in a PK bridging ELISA together with HCA386 as the detection antibody.
Protocol: PK Bridging ELISA
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Hispec Assay Diluent | BUF049A | E IY | 50 ml | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Hispec Assay Diluent | ||||||
Human anti Aflibercept | HCA386 | E | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Human anti Aflibercept | ||||||
Human anti Aflibercept | HCA387 | E | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Human anti Aflibercept | ||||||
Human anti Aflibercept | HCA388 | E | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Human anti Aflibercept | ||||||
Human anti Aflibercept | HCA389 | E | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Human anti Aflibercept |
- Synonyms
- Eylea
- Zaltrap
HCA390
168423If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
Always be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up