Browsing Modes for Business Users

Aflibercept antibody | AbD38778da

Human anti Aflibercept

Product Type
Monoclonal Antibody
Clone
AbD38778da
Isotype
HuCAL Fab monovalent
Specificity
Aflibercept

Product Code Applications Pack Size List Price Your Price Qty
New HCA390
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E 0.1 mg loader
List Price Your Price
loader

Human Anti-Aflibercept Antibody, clone AbD38778da is a recombinant antibody that specifically recognizes the fusion protein drug aflibercept as well as the vascular endothelial growth factor receptor 1 (VEGFR1). It does not recognize vascular endothelial growth factor receptor 2 (VEGFR2). It does not inhibit the binding of aflibercept to its target, the vascular endothelial growth factor (VEGF); it binds to both free aflibercept and aflibercept bound to its target VEGF and can be used to measure levels of aflibercept and its biosimilars in bioanalytical assays.

A pair of anti-aflibercept antibodies can be used to develop a pharmacokinetic (PK) bridging assay to measure free drug. This antibody, in monovalent Fab format, is recommended as the capture antibody, paired with the Human Anti-Aflibercept Antibody, clone AbD34644ia (HCA386) as the detection antibody.

Aflibercept (Eylea, Zaltrap) is a recombinant fusion protein consisting of the extra-cellular domain of human VEGF receptors 1 and 2, fused to the Fc portion of human IgG1. It is used to treat the 'wet' form of age-related macular degeneration (AMD) and impaired vision due to macular oedema. It is also used in the treatment of metastatic colorectal cancer in combination with 5-fluorouracil, leucovorin and irinotecan in patients previously treated with an oxaliplatin-containing chemotherapy. Aflibercept binds to circulating VEGF-A and VEGF-B to inhibit their ability to promote angiogenesis.

View a summary of all anti aflibercept antibodies

Product Form
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) at the C-terminus of the antibody heavy chain. This antibody is supplied as a liquid.
Preparation
Metal chelate affinity chromatography
Source
E. coli
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
Immunogen
Aflibercept
Affinity
The intrinsic affinity of the monovalent form of Human anti Aflibercept antibody, clone AbD38778da is KD = 4 nM as measured by real time, label free molecular interaction analysis on immobilized Aflibercept
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml
Regulatory
For research purposes only
Guarantee
12 months from date of despatch
Acknowledgements
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Eylea is a trademark of Regeneron/Sanofi.
Zaltrap is a trademark of Regeneron/Bayer Healthcare.
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
This antibody contains a Strep-tag and will react with streptavidin.
ELISA
Human anti Aflibercept antibody, clone AbD38778da can be used in an indirect ELISA. It can also be used as the capture antibody for aflibercept in a PK bridging ELISA together with HCA386 as the detection antibody.

Protocol: PK Bridging ELISA

Description Product Code Applications Pack Size List Price Your Price Quantity
Hispec Assay Diluent BUF049A E IY 50 ml
List Price Your Price
Description Hispec Assay Diluent
Human anti Aflibercept HCA386 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Aflibercept
Human anti Aflibercept HCA387 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Aflibercept
Human anti Aflibercept HCA388 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Aflibercept
Human anti Aflibercept HCA389 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Aflibercept

Synonyms
Eylea
Zaltrap

HCA390

168423

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

View more products with Aflibercept specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

Please note