Beta Amyloid

//www.bio-rad-antibodies.com/human-beta-amyloid-antigen-spt002g.html?RenderPageSpecific=1
Beta Amyloid gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

Enlarge
  • Beta Amyloid thumbnail image 1
  • Synthetic Human Beta Amyloid (aa1-40)
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Antigen
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    SPT002GEdatasheet pdfdatasheet pdf1 mg
    SPT002G
    Summary
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    References
    Reviews
    -
    • SPT002G is a synthetic peptide corresponding to full-length human beta amyloid 40, a major component of amyloid plaques.
    • Intended Use
    • Target Species
      Human
    • Product Form
      Purified synthetic human amyloid beta protein (aa1-40) - lyophilised.
    • Reconstitution
      Reconstitute with 1ml deionised water
    • Preparation
    • Preservative Stabilisers
      None present
    • Peptide Sequence
      DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Purity
      100% by HPLC
    • Approx. Protein Concentrations
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
    • Storage
      Prior to reconstitution store at +4oC.
      After reconstitution store at -20oC.
      Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the protein. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      18 months from date of reconstitution.
    • UniProt
    • Entrez Gene
    • Acknowledgements
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      ELISA

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using the appropriate negative/positive controls.
    • Technical Advice
    • Recommended Protocol
    • ELISA
    • Immunohistology
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional Beta Amyloid Formats

    Formats Applications Sizes available
    Beta Amyloid : Purified E 1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              Write your review

               
              No experiment is complete without all the pieces

              You may also be interested in...