Human Immunodeficiency Virus 1 p66/55 Antibody

//www.bio-rad-antibodies.com/viral-human-immunodeficiency-virus-1-p66-55-antibody-ahp2211.html?RenderPageSpecific=1
Human Immunodeficiency Virus 1 p66/55 Antibody gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

Enlarge
  • Human Immunodeficiency Virus 1 p66/55 Antibody thumbnail image 1
  • Goat anti Human Immunodeficiency Virus 1 p66/55 (aa254-295)
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Polyclonal Antibody
  • Isotype
    Polyclonal IgG
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    AHP2211E, WBdatasheet pdfdatasheet pdf1 mg
    AHP2211
    Summary
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    References
    Reviews
    -
    • Goat anti Human immunodeficiency virus p66/55 antibody recognizes p66/55, a cleavage product of the gag-pol polyprotein. Goat anti Human immunodeficiency virus p66/55 antibody has minimal cross reactivity with p39 and gp41 in western blotting.
    • Intended Use
    • Target Species
      Viral
    • Product Form
      Purified IgG - liquid
    • Reconstitution
    • Preparation
    • Preservative Stabilisers
      0.09% Sodium Azide (NaN3)
    • Immunogen
      Synthetic HIV p24 peptide GLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETP.
    • Purity
      >98%
    • Approx. Protein Concentrations
      IgG concentration 1.0 mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      150mM Sodium chloride
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      18 months from date of despatch.
    • Acknowledgements
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      ELISA1/501/500
      Western Blotting1/501/500

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using the appropriate negative/positive controls.
    • Technical Advice
    • Recommended Protocol
    • ELISA
    • Immunohistology
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional Human Immunodeficiency Virus 1 p66/55 Antibody Formats

    Formats Applications Sizes available
    Human Immunodeficiency Virus 1 p66/55 Antibody : Purified E, WB 1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Rabbit anti Goat IgG (Fc):FITCSTAR122F1 mgF
      STAR122F
      Rabbit anti Goat IgG (Fc):HRPSTAR122P1 mgC, E, WB
      STAR122P

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              Write your review

               
              No experiment is complete without all the pieces

              You may also be interested in...