Browsing Modes for Business Users

Ustekinumab antibody | AbD17829

Human anti Ustekinumab

Product Type
Monoclonal Antibody
Clone
AbD17829
Isotype
HuCAL Fab monovalent
Specificity
Ustekinumab

Product Code Applications Pack Size List Price Your Price Qty
HCA208
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E 0.1 mg loader
List Price Your Price
loader

Human Anti-Ustekinumab Antibody, clone AbD17829 is a paratope specific, anti-idiotypic antibody that specifically recognizes the monoclonal antibody drug ustekinumab and inhibits binding to its target. The antibody can be used to measure the level of free ustekinumab and biosimilar products in bioanalytical and patient monitoring assays.

A pair of anti-ustekinumab antibodies can be used to develop a pharmacokinetic (PK) bridging assay to measure free drug. This antibody, in monovalent Fab format, is recommended as a capture antibody, paired with an HRP conjugated Anti-Ustekinumab Antibody in full immunoglobulin format, clone AbD17827_hIgG1 (HCA210) as the detection antibody.

Ustekinumab (Stelara) is a fully human monoclonal antibody drug (IgG1/kappa) that has been approved in US, Canada, and Europe for the treatment of plaque psoriasis and psoriatic arthritis. The FDA approved the medication for the treatment of moderate-severe Crohn's disease in 2016. The drug blocks interleukin IL-12 and IL-23 by binding with high affinity and specificity to the p40 subunit, preventing the binding of these two cytokines to T-lymphocytes, and thereby disrupting the proinflammatory pathway.

View a summary of all anti-ustekinumab antibodies

Product Form
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
Preparation
StrepTactin affinity chromatography
Source
E.coli
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
Immunogen
Ustekinumab
Affinity
The intrinsic affinity of the monovalent form of Human anti Ustekinumab antibody, clone AbD17829 is KD = 2.8 nM as measured by real time, label free molecular interaction analysis on immobilized ustekinumab.
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml
Regulatory
For research purposes only
Guarantee
12 months from date of despatch
Acknowledgements
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.

This antibody contains Strep-tag and will react with streptavidin.
ELISA
This product may be used as a capture antibody in a sandwich ELISA together with HCA210P as the detection reagent.
Protocol: PK bridging ELISA to measure free drug.

Description Product Code Applications Pack Size List Price Your Price Quantity
Mouse anti V5-Tag:Biotin MCA1360B C E WB 0.1 mg loader
List Price Your Price
loader
Description Mouse anti V5-Tag:Biotin
Mouse anti V5-Tag:HRP MCA1360P E WB 0.1 mg loader
List Price Your Price
loader
Description Mouse anti V5-Tag:HRP
Mouse anti Strep-Tag Classic:HRP MCA2489P E WB 75 µl loader
List Price Your Price
loader
Description Mouse anti Strep-Tag Classic:HRP
Mouse anti Human IgG (Fc) CH2 Domain:HRP MCA647P C * E 0.2 mg loader
List Price Your Price
loader
Description Mouse anti Human IgG (Fc) CH2 Domain:HRP

Synonyms
Stelara®
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.

HCA208

152187 157800 1808

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

View more products with USTEKINUMAB specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

Please note