Browsing Modes for Business Users

CD62L antibody

Rabbit anti CD62L

Product Type
PrecisionAb Polyclonal
Isotype
Polyclonal IgG
Format
Purified
Specificity
CD62L

Product Code Applications Pack Size List Price Your Price Qty
VPA00599
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
WB 100 µl loader
List Price Your Price
loader

Rabbit anti Human CD62L antibody recognizes CD62L also known as L-selectin, CD62 antigen-like family member L, leukocyte surface antigen Leu-8, leukocyte-endothelial cell adhesion molecule 1, lymph node homing receptor, lymphocyte adhesion molecule 1, TQ1 or gp90-MEL.

The SELL gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in SELL have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for SELL (provided by RefSeq, Oct 2009).

Rabbit anti Human CD62L antibody detects a band of 42 kDa. The antibody has been extensively validated for western blotting using whole cell lysates.
PrecisionAb Antibodies

Target Species
Human
Western Blotting
Anti CD62L detects a band of approximately 42 kDa in HepG2 cell lysates.
Species Cross-Reactivity
Target SpeciesCross Reactivity
Mouse
N.B. Antibody reactivity and working conditions may vary between species.
Product Form
Purified IgG - liquid.
Preparation
Rabbit polyclonal antibody purified by affinity chromatography.
Buffer Solution
Phosphate buffered saline.
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
2% Sucrose.
Immunogen
Synthetic peptide - FSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Regulatory
For research purposes only.
Guarantee
12 months from date of despatch.
Acknowledgements
PrecisionAb is a trademark of Bio-Rad Laboratories.

Store undiluted at -20°C, avoiding repeated freeze thaw cycles.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Western Blotting 1/1000
The PrecisionAb label is reserved for antibodies that meet the defined performance criteria within Bio-Rad's ongoing antibody validation programme. Click here to learn how we validate our PrecisionAb range. Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Further optimization may be required dependent on sample type.

Description Product Code Applications Pack Size List Price Your Price Quantity
Goat anti Rabbit IgG (H/L):HRP STAR208P WB 2 ml loader
List Price Your Price
loader
Description Goat anti Rabbit IgG (H/L):HRP

UniProt
P14151
Entrez Gene
SELL
GO Terms
GO:0007596 blood coagulation
GO:0007155 cell adhesion
GO:0005887 integral to plasma membrane
GO:0005529 sugar binding
GO:0008201 heparin binding
GO:0043208 glycosphingolipid binding
GO:0050776 regulation of immune response
GO:0050900 leukocyte migration

VPA00599

160801

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

Request a different product with this specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

View all Anti-Human Products
Please note