Human Immunodeficiency Virus 1 gp41 antibody

Goat anti Human Immunodeficiency Virus 1 gp41 (aa502-541)
- Product Type
- Polyclonal Antibody
- Isotype
- Polyclonal IgG
- Specificity
- Human Immunodeficiency Virus 1 gp41
- Region
- (aa502-541)
Goat anti Human immunogeficiency virus gp41 antibody recognizes gp41 from human immunodeficiency virus 1. After cleavage of gp160 into gp120 and gp41, gp41 remains non-covalently bound to gp120 and aids the virus in entering the cell. |
- Target Species
- Viral
- Product Form
- Purified IgG - liquid
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- <0.1% Sodium Azide (NaN3)
- Immunogen
- Synthetic peptide RVVQREKRAVGIVGAMFLGFLGAAGSTMGAVSLTLTVQAR.
- Purity
- >98%
- Approx. Protein Concentrations
- IgG concentration 1.0 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | ![]() |
1/50 | 1/500 |
Immunoblotting | ![]() |
1/50 | 1/500 |
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Rabbit anti Goat IgG (Fc):FITC | STAR122F | F | 1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Rabbit anti Goat IgG (Fc):FITC | ||||||
Rabbit anti Goat IgG (Fc):HRP | STAR122P | C E WB | 1 mg |
![]() |
Log in | ||
List Price | Your Price | ||||||
![]() |
Log in | ||||||
Description | Rabbit anti Goat IgG (Fc):HRP |
- Synonyms
- HIV-1
- RRID
- AB_10851406
- UniProt
- Q70626
- GO Terms
- GO:0006915 apoptosis
- GO:0016021 integral to membrane
- GO:0005198 structural molecule activity
- GO:0019031 viral envelope
- GO:0019059 initiation of viral infection
- GO:0020002 host cell plasma membrane
- GO:0030260 entry into host cell
- GO:0030683 evasion by virus of host immune response
- GO:0044175 host cell endosome membrane
- View More GO Terms
- GO:0055036 virion membrane
AHP2208

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Viral ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up