Human Immunodeficiency Virus 1 gp41 antibody

Product Details
- Target Species
- Viral
- Product Form
- Purified IgG - liquid
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Synthetic peptide RVVQREKRAVGIVGAMFLGFLGAAGSTMGAVSLTLTVQAR.
- Purity
- >98%
- Approx. Protein Concentrations
- IgG concentration 1.0 mg/ml
Storage Information
- Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Guarantee
- 12 months from date of despatch
More Information
- UniProt
- Q70626
- GO Terms
- GO:0006915 apoptosis
- GO:0016021 integral to membrane
- GO:0005198 structural molecule activity
- GO:0019031 viral envelope
- GO:0019059 initiation of viral infection
- GO:0020002 host cell plasma membrane
- GO:0030260 entry into host cell
- GO:0030683 evasion by virus of host immune response
- GO:0044175 host cell endosome membrane
- GO:0055036 virion membrane
- Regulatory
- For research purposes only
Applications of Human Immunodeficiency Virus 1 gp41 antibody
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | 1/50 | 1/500 | |
Immunoblotting | 1/50 | 1/500 |
Secondary Antibodies Available
Description | Product Code | Applications | Pack Size | List Price | Quantity |
---|---|---|---|---|---|
Rabbit anti Goat IgG (Fc):FITC | STAR122F | F | 1 mg |
![]() |
|
Rabbit anti Goat IgG (Fc):HRP | STAR122P | C E WB | 1 mg |
![]() |
Fluorescent Spectraviewer
Watch the Tool Tutorial Video ▸
How to Use the Spectraviewer?
Watch the Tool Tutorial Video ▸
- Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
- Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
- Select the lasers and filters you wish to include
- Select combined or multi-laser view to visualize the spectra