IL-21 Receptor antibody

100% Secure

Goat anti Human Interleukin-21 Receptor (N-Terminal)

Product Type
Polyclonal Antibody
Polyclonal IgG
Product Code Applications Pack Size List Price Quantity
0.1 mg loader

Rabbit anti Human interleukin-21 receptor antibody recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21.

Interaction between IL-21R and IL-21 results in the activation of several downstream signaling molecules including JAK1 and STAT1 and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.

Product Details

Target Species
Product Form
Purified IgG - liquid
Antiserum Preparation
Antiserum to human IL-21R (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.1% Sodium Azide (NaN3)
0.1% Bovine Serum Albumin
Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R.
Approx. Protein Concentrations
IgG concentration 1.0mg/ml

Storage Information

Store at -20oC only.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
12 months from date of despatch

More Information

Entrez Gene
GO Terms
GO:0001532 interleukin-21 receptor activity
GO:0016021 integral to membrane
GO:0030101 natural killer cell activation
For research purposes only

Applications of IL-21 Receptor antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA 1/50,000
Immunohistology - Paraffin 1/150
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
This product is suitable for use in indirect ELISA applications.
Histology Positive Control Tissue
Human lung or tonsil.

Secondary Antibodies Available

Description Product Code Applications Pack Size List Price Quantity
Rabbit anti Goat IgG (Fc):FITC STAR122F F 1 mg loader
Rabbit anti Goat IgG (Fc):HRP STAR122P C E WB 1 mg loader

Useful Reagents Available

Description Product Code Applications Pack Size List Price Quantity
Antigen Retrieval Buffer, pH8.0 BUF025A P 500 ml
100x Antigen Retrieval Buffer, pH8.0 BUF025C P 50 ml

Product Specific References

References for IL-21 Receptor antibody

  1. Coit, P. et al. (2016) DNA methylation analysis of the temporal artery microenvironment in giant cell arteritis.
    Ann Rheum Dis. 75 (6): 1196-202.

Fluorescent Spectraviewer

Watch the Tool Tutorial Video ▸

How to Use the Spectraviewer

Watch the Tool Tutorial Video ▸
  • Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
  • Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
  • Select the lasers and filters you wish to include
  • Select combined or multi-laser view to visualize the spectra