IL-21 Receptor antibody
Filter by Application:
P ResetGoat anti Human Interleukin-21 Receptor (N-Terminal)
- Product Type
- Polyclonal Antibody
- Isotype
- Polyclonal IgG
- Specificity
- IL-21 Receptor
- Region
- (N-TERMINAL)
Antibody Quality and Performance Guarantee
| Rabbit anti Human interleukin-21 receptor antibody recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21. Interaction between IL-21R and IL-21 results in the activation of several downstream signaling molecules including JAK1 and STAT1 and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells. |
- Target Species
- Human
- Product Form
- Purified IgG - liquid
- Antiserum Preparation
- Antiserum to human IL-21R (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.1% Sodium Azide (NaN3)
0.1% Bovine Serum Albumin - Immunogen
- Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R.
- Approx. Protein Concentrations
- IgG concentration 1.0mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
Store at -20oC only.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
| Application Name | Verified | Min Dilution | Max Dilution |
|---|---|---|---|
| ELISA |  |
1/50,000 | |
| Immunohistology - Paraffin | |
1/150 |
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- ELISA
- This product is suitable for use in indirect ELISA applications.
- Histology Positive Control Tissue
- Human lung or tonsil.
| Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
|---|---|---|---|---|---|---|---|
| Rabbit anti Goat IgG (Fc):FITC | STAR122F | F | 1 mg |
 |
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Rabbit anti Goat IgG (Fc):FITC | ||||||
| Rabbit anti Goat IgG (Fc):HRP | STAR122P | C E WB | 1 mg |
|
Log in | ||
| List Price | Your Price | ||||||
|
|
Log in | ||||||
| Description | Rabbit anti Goat IgG (Fc):HRP | ||||||
| Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
|---|---|---|---|---|---|---|---|
| Antigen Retrieval Buffer, pH8.0 | BUF025A | P | 500 ml | Log in | |||
| List Price | Your Price | ||||||
| Log in | |||||||
| Description | Antigen Retrieval Buffer, pH8.0 | ||||||
References for IL-21 Receptor antibody
-
Coit, P. et al. (2016) DNA methylation analysis of the temporal artery microenvironment in giant cell arteritis.
Ann Rheum Dis. 75 (6): 1196-202.
- RRID
- AB_2124103
- UniProt
- Q9HBE5
- Entrez Gene
- IL21R
- GO Terms
- GO:0001532 interleukin-21 receptor activity
- GO:0016021 integral to membrane
- GO:0030101 natural killer cell activation
AHP1819
160830
161005
If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
View more products with IL-21 RECEPTOR specificity
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
View all Anti-Human ProductsAlways be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up