Vimentin antibody | AbD08866

100% Secure

Human anti Human Vimentin

Product Type
Monoclonal Antibody
HuCAL Fab bivalent
Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
HCA111 C E P 0.1 mg
Human anti Human vimentin antibody, clone AbD08866 recognizes human vimentin, a class III intermediate filament of 54 kDa. Vimentin is preferentially expressed in mesenchymal tissues, and within the immune system is retained throughout T-cell development, with decreasing expression in B lymphocytes with maturation.

In lymphatic tissues vimentin expression is seen in marginal zone areas, but not in follicle centers. A lack of vimentin expression in B cell lymphoma is indicative of follicular center origin.

Product Details

Target Species
Product Form
A lyophilized, bivalent human recombinant Fab selected from the HuCAL ® GOLD phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
Reconstitute with 1.0 ml distilled water
Care should be taken during reconstitution as the protein may appear as a film at the bottom of the vial. Bio-Rad recommend that the vial is gently mixed after reconstitution.
Metal chelate affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
1% Bovine Serum Albumin
Formalin fixed, parafin-embedded human lymphoma tissue
Approx. Protein Concentrations
Antibody concentration 0.1 mg/ml following reconstitution

Storage Information

Prior to reconstitution store at +4oC.
After reconstitution store at -20oC.
Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody.
Shelf Life
12 months from date of reconstitution

More Information

P08670 Related reagents
Entrez Gene
VIM Related reagents
Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
For research purposes only

Applications of Vimentin antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Immunohistology - Frozen
Immunohistology - Paraffin 1/50 1/200
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Due to the presence of bovine serum albumin (BSA), this antibody is unsuitable for use as a capture reagent in sandwich ELISA applications. This product is also available without BSA, please enquire.

Secondary Antibodies Available

Description Product Code Pack Size Applications List Price Quantity
Mouse anti c-Myc:HRP MCA2200P 0.1 mg C E P WB*
Mouse anti Strep-Tag Classic:HRP MCA2489P 75 µl E WB

Product Specific References

References for Vimentin antibody

  1. Jarutat, J. et al. (2007) Selection of vimentin-specific antibodies from the HuCAL phage display library by subtractive panning on formalin-fixed, paraffin-embedded tissue.
    Biol. Chem. 388: 651-658.