GDF9 antibody | mAb-GDF9-53

100% Secure


Mouse anti Human GDF9

Product Type
Monoclonal Antibody
Clone
mAb-GDF9-53
Isotype
IgG
Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
MCA5635GA C FN P* WB 0.1 mg
Mouse anti Human GDF9 antibody, clone mAb-GDF9-53 recognizes an epitope within the highly conserved EPDG sequence of GDF9 (growth differentiation factor 9), a 454 amino acid ~51 kDa pro-protein which is cleaved to form a ~17.5 kDa GDF9 monomer which self associates to form an active homodimeric growth factor, a member of the TGF-beta superfamily, closely related to bone morphogenetic proteins (BMPs).

GDF9 is expressed by oocytes, playing a vital role in ovarian folliculogenesis, normal follicle development, and fertility. GDF9 signals through binding to bone morphogenetic protein type II receptor (BMPRII), and apparent subsequent activation of TGF-beta type I receptor, otherwise known as activin receptor-like kinase-5 (ALK-5).

Mouse anti Human GDF9 antibody, clone mAb-GDF9-53 recognises GDF9 with high immuno-affinity, and has been shown to neutralize GDF9 biological activity (Gilchrist et al. 2004, Dragovic et al. 2005).

Removal of sodium azide is recommended prior to use in functional assays – Bio-Rad recommend the use of EQU003 for this purpose.

Product Details

Target Species
Human
Species Cross-Reactivity
Target SpeciesCross Reactivity
Mouse
Sheep
N.B. Antibody reactivity and working conditions may vary between species.
Product Form
Purified IgG - liquid
Preparation
Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
Immunogen
Tuberculin coupled synthetic peptide VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from near the C-terminal region of mature human GDF9.
Approx. Protein Concentrations
IgG concentration 1.0mg/ml
Fusion Partners
Spleen cells from immunised Balb/c mice were fused with cells of the SP2/0 myeloma cell line.

Storage Information

Storage
Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life
18 months from date of despatch.

More Information

UniProt
O60383 Related reagents
Q07105 Related reagents
O77681 Related reagents
Entrez Gene
GDF9 Related reagents
GDF9 Related reagents
Gdf9 Related reagents
GO Terms
GO:0005125 cytokine activity
GO:0005615 extracellular space
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0008083 growth factor activity
GO:0001555 oocyte growth
GO:0030308 negative regulation of cell growth
Regulatory
For research purposes only

Applications of GDF9 antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Functional Assays
Immunohistology - Frozen
Immunohistology - Paraffin 1 1/25 1/100
Western Blotting 1/100 1/1000
  1. 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Histology Positive Control Tissue
Human ovary

Secondary Antibodies Available

Description Product Code Pack Size Applications List Price Quantity
Human anti Mouse IgG1:HRP HCA036P 0.1 mg E
Human anti Mouse IgG2a:FITC HCA037F 0.1 mg F
Human anti Mouse IgG2a:HRP HCA037P 0.1 mg E
Human anti Mouse IgG2b:FITC HCA038F 0.1 mg F
Human anti Mouse IgG2b:HRP HCA038P 0.1 mg E
Human anti Mouse IgG3:FITC HCA039F 0.1 mg F
Human anti Mouse IgG3:HRP HCA039P 0.1 mg E
Human anti Mouse IgG3:RPE HCA039PE 100 Tests F
Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed) STAR117A 0.5 mg E WB
Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed) STAR117D488GA 0.1 mg F IF
Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed) STAR117D549GA 0.1 mg F IF WB
Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed) STAR117D649GA 0.1 mg F IF
Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed) STAR117D680GA 0.1 mg F WB
Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed) STAR117D800GA 0.1 mg F IF WB
Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed) STAR117F 0.5 mg F
Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed) STAR117P 0.5 mg E WB
Goat anti Mouse IgG (Fc):FITC STAR120F 1 mg C F
Goat anti Mouse IgG (Fc):HRP STAR120P 1 mg E WB
Rabbit F(ab')2 anti Mouse IgG:RPE STAR12A 1 ml F
Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed) STAR13B 1 mg C E P RE WB
Goat anti Mouse IgG:FITC (Rat Adsorbed) STAR70 0.5 mg F
Goat anti Mouse IgG:RPE (Rat Adsorbed) STAR76 1 ml F
Goat anti Mouse IgG:HRP (Rat Adsorbed) STAR77 0.5 mg C E P
Goat anti Mouse IgG/A/M:Alk. Phos. STAR87A 1 mg C E WB
Goat anti Mouse IgG/A/M:HRP (Human Adsorbed) STAR87P 1 mg E
Rabbit F(ab')2 anti Mouse IgG:Dylight®800 STAR8D800GA 0.1 mg F IF WB
Rabbit F(ab')2 anti Mouse IgG:FITC STAR9B 1 mg F

Product Specific References

References for GDF9 antibody

  1. Gilchrist RB et al. (2004) Immunoneutralization of growth differentiation factor 9 reveals it partially accounts for mouse oocyte mitogenic activity.
    Biol Reprod. 71 (3): 732-9.
  2. Dragovic RA et al. (2005) Role of oocyte-secreted growth differentiation factor 9 in the regulation of mouse cumulus expansion.
    Endocrinology. 146 (6): 2798-806.
  3. Simpson, C.M. et al. (2012) Activation of Latent Human GDF9 by a Single Residue Change (Gly391Arg) in the Mature Domain.
    Endocrinology. 153: 1301-10.
  4. Watson, L.N. et al. (2012) Heparan sulfate proteoglycans regulate responses to oocyte paracrine signals in ovarian follicle morphogenesis.
    Endocrinology. 153: 4544-55.
  5. Li, J.J. et al. (2014) Modifications of human growth differentiation factor 9 to improve the generation of embryos from low competence oocytes.
    Mol Endocrinol. me20141173.
  6. Mottershead, D.G. et al. (2008) Characterization of recombinant human growth differentiation factor-9 signaling in ovarian granulosa cells.
    Mol Cell Endocrinol. 283: 58-67.
  7. Pulkki, M.M. et al. (2011) The bioactivity of human bone morphogenetic protein-15 is sensitive to C-terminal modification: characterization of the purified untagged processed mature region.
    Mol Cell Endocrinol. 332: 106-15.