GDF9 antibody | mAb-GDF9-53
Mouse anti Human GDF9 antibody, clone mAb-GDF9-53 recognizes an epitope within the highly conserved EPDG sequence of GDF9 (growth differentiation factor 9), a 454 amino acid ~51 kDa pro-protein which is cleaved to form a ~17.5 kDa GDF9 monomer which self associates to form an active homodimeric growth factor, a member of the TGF-beta superfamily, closely related to bone morphogenetic proteins (BMPs).
GDF9 is expressed by oocytes, playing a vital role in ovarian folliculogenesis, normal follicle development, and fertility. GDF9 signals through binding to bone morphogenetic protein type II receptor (BMPRII), and apparent subsequent activation of TGF-beta type I receptor, otherwise known as activin receptor-like kinase-5 (ALK-5).
Mouse anti Human GDF9 antibody, clone mAb-GDF9-53 recognises GDF9 with high immuno-affinity, and has been shown to neutralize GDF9 biological activity (Gilchrist et al. 2004, Dragovic et al. 2005).
Removal of sodium azide is recommended prior to use in functional assays – Bio-Rad recommend the use of EQU003 for this purpose.
GDF9 is expressed by oocytes, playing a vital role in ovarian folliculogenesis, normal follicle development, and fertility. GDF9 signals through binding to bone morphogenetic protein type II receptor (BMPRII), and apparent subsequent activation of TGF-beta type I receptor, otherwise known as activin receptor-like kinase-5 (ALK-5).
Mouse anti Human GDF9 antibody, clone mAb-GDF9-53 recognises GDF9 with high immuno-affinity, and has been shown to neutralize GDF9 biological activity (Gilchrist et al. 2004, Dragovic et al. 2005).
Removal of sodium azide is recommended prior to use in functional assays – Bio-Rad recommend the use of EQU003 for this purpose.
Product Details
- Target Species
- Human
- Species Cross-Reactivity
-
Target Species Cross Reactivity Mouse Sheep - N.B. Antibody reactivity and working conditions may vary between species.
- Product Form
- Purified IgG - liquid
- Preparation
- Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Tuberculin coupled synthetic peptide VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from near the C-terminal region of mature human GDF9.
- Approx. Protein Concentrations
- IgG concentration 1.0mg/ml
- Fusion Partners
- Spleen cells from immunised Balb/c mice were fused with cells of the SP2/0 myeloma cell line.
Storage Information
- Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Shelf Life
- 18 months from date of despatch.
More Information
- UniProt
- O60383 Related reagents
- Q07105 Related reagents
- O77681 Related reagents
- Entrez Gene
- GDF9 Related reagents
- GDF9 Related reagents
- Gdf9 Related reagents
- GO Terms
- GO:0005125 cytokine activity
- GO:0005615 extracellular space
- GO:0007179 transforming growth factor beta receptor signaling pathway
- GO:0008083 growth factor activity
- GO:0001555 oocyte growth
- GO:0030308 negative regulation of cell growth
- Regulatory
- For research purposes only
Applications of GDF9 antibody
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
Functional Assays | |||
Immunohistology - Frozen | |||
Immunohistology - Paraffin 1 | 1/25 | 1/100 | |
Western Blotting | 1/100 | 1/1000 |
- 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- Histology Positive Control Tissue
- Human ovary
Copyright © 2019 Bio-Rad Antibodies (formerly AbD Serotec)
Secondary Antibodies Available
Product Specific References
References for GDF9 antibody
-
Gilchrist RB et al. (2004) Immunoneutralization of growth differentiation factor 9 reveals it partially accounts for mouse oocyte mitogenic activity.
Biol Reprod. 71 (3): 732-9. -
Dragovic RA et al. (2005) Role of oocyte-secreted growth differentiation factor 9 in the regulation of mouse cumulus expansion.
Endocrinology. 146 (6): 2798-806. -
Simpson, C.M. et al. (2012) Activation of Latent Human GDF9 by a Single Residue Change (Gly391Arg) in the Mature Domain.
Endocrinology. 153: 1301-10. -
Watson, L.N. et al. (2012) Heparan sulfate proteoglycans regulate responses to oocyte paracrine signals in ovarian follicle morphogenesis.
Endocrinology. 153: 4544-55. -
Li, J.J. et al. (2014) Modifications of human growth differentiation factor 9 to improve the generation of embryos from low competence oocytes.
Mol Endocrinol. me20141173. -
Mottershead, D.G. et al. (2008) Characterization of recombinant human growth differentiation factor-9 signaling in ovarian granulosa cells.
Mol Cell Endocrinol. 283: 58-67. -
Pulkki, M.M. et al. (2011) The bioactivity of human bone morphogenetic protein-15 is sensitive to C-terminal modification: characterization of the purified untagged processed mature region.
Mol Cell Endocrinol. 332: 106-15.