CD81 antibody | AbD08863

100% Secure

Human anti Human CD81

Product Type
Monoclonal Antibody
HuCAL Fab bivalent
Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
HCA112 E F 0.1 mg
Human anti human CD81 antibody, clone AbD08863 specifically recognizes human CD81, which is a 26 kDa member of the TM4SF tetraspanin family. In humans, CD81 is widely expressed on most tissues with T-cells having the highest level of expression, followed by monocytes and B-cells. Levels of CD81 expression are increased after activation.

CD81 has the ability to interact with a wide range of proteins and plays an important role in a variety of leucocyte functions including activation, proliferation and differentiation. In recent studies, the CD81 molecule has been identified as the putative receptor for the Hepatitis C Virus envelope E2 glycoprotein and is vital for HCV entry into hepatic cells.

Product Details

Target Species
Product Form
A bivalent human recombinant Fab selected from the HuCAL ® phage display library, expressed in E. coli.. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.01% Thiomersal
Recombinant human CD81
Approx. Protein Concentrations
Total protein concentration 0.5 mg/ml

Storage Information

Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life
12 months from date of despatch

More Information

P60033 Related reagents
Entrez Gene
CD81 Related reagents
GO Terms
GO:0000187 activation of MAPK activity
GO:0005515 protein binding
GO:0008104 protein localization
GO:0005887 integral to plasma membrane
GO:0006661 phosphatidylinositol biosynthetic process
GO:0008283 cell proliferation
GO:0008284 positive regulation of cell proliferation
GO:0043128 positive regulation of 1-phosphatidylinositol 4-kinase activity
GO:0046813 virion attachment, binding of host cell surface receptor
GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
GO:0050776 regulation of immune response
Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
For research purposes only

Applications of CD81 antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Flow Cytometry Neat 1/10
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual

Secondary Antibodies Available

Description Product Code Pack Size Applications List Price Quantity
Mouse anti Strep-Tag Immo MCA2488 0.1 mg E
Rabbit F(ab')2 anti Mouse IgG:FITC STAR9B 1 mg F

Negative Isotype Controls Available

Description Product Code Pack Size Applications List Price Quantity
HuCAL Fab-dHLX-MSx2 Negative Control HCA102 0.1 mg C E F P WB