Activin Beta antibody | betaC clone 1

100% Secure

Mouse anti Human Activin BetaC-Subunit

Product Type
Monoclonal Antibody
Clone
betaC clone 1
Isotype
IgG1
Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
MCA2535GA E P* WB 0.1 mg
Mouse anti Human Activin betaC-subunit antibody, clone 1 recognizes the BetaC-subunit of Activin (BetaC-activin), a member of the transforming growth factor beta (TGF-beta) superfamily and one of a group of proteins which regulate growth and differentiation in a range of cells and tissues, via both autocrine and paracrine pathways.

Activins were originally characterised by the formation of specific homo- and heterodimers of activin BetaA- or BetaB-subunits, but additional subunits of activin have since been identified including BetaC, BetaD and BetaE. BetaC-activin, expressed in the liver, prostrate, ovary and testis, has been shown to exhibit both growth promoting and inhibitory properties, and evidence suggests that BetaC-activin can form BetaC homodimers and also heterodimers with BetaA (putative activin AC) and BetaB (putative activin BC).

Clone betaC clone 1 has been shown to recognize both monomeric and dimeric BetaC-activin and does not cross react with BetaA, BetaB or BetaE.

Product Details

Target Species
Human
Species Cross-Reactivity
Target SpeciesCross Reactivity
Rat
N.B. Antibody reactivity and working conditions may vary between species.
Product Form
Purified IgG - liquid
Preparation
Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
Immunogen
Synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit.
Approx. Protein Concentrations
IgG concentration 0.5mg/ml

Storage Information

Storage
Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life
18 months from date of despatch.

More Information

UniProt
P55103 Related reagents
Entrez Gene
INHBC Related reagents
GO Terms
GO:0005576 extracellular region
GO:0005160 transforming growth factor beta receptor binding
GO:0005179 hormone activity
GO:0040007 growth
GO:0008083 growth factor activity
Regulatory
For research purposes only

Applications of Activin Beta antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Immunohistology - Paraffin 1
Western Blotting 1/5000
  1. 1This product requires antigen retrieval using heat treatment prior to staining of paraffin sections, 0.01 mol/L glycine buffer solution (pH 4.4) is recommended for this purpose. See Mellor et al. for details.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Histology Positive Control Tissue
Liver. Staining localises to hepatocytes.

Secondary Antibodies Available

Description Product Code Pack Size Applications List Price Quantity
Human anti Mouse IgG1:HRP HCA036P 0.1 mg E
Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed) STAR117A 0.5 mg E WB
Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed) STAR117D488GA 0.1 mg F IF
Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed) STAR117D549GA 0.1 mg F IF WB
Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed) STAR117D649GA 0.1 mg F IF
Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed) STAR117D680GA 0.1 mg F WB
Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed) STAR117D800GA 0.1 mg F IF WB
Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed) STAR117F 0.5 mg F
Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed) STAR117P 0.5 mg E WB
Goat anti Mouse IgG (Fc):FITC STAR120F 1 mg C F
Goat anti Mouse IgG (Fc):HRP STAR120P 1 mg E WB
Rabbit F(ab')2 anti Mouse IgG:RPE STAR12A 1 ml F
Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed) STAR13B 1 mg C E P RE WB
Goat anti Mouse IgG:FITC (Rat Adsorbed) STAR70 0.5 mg F
Goat anti Mouse IgG:RPE (Rat Adsorbed) STAR76 1 ml F
Goat anti Mouse IgG:HRP (Rat Adsorbed) STAR77 0.5 mg C E P
Goat anti Mouse IgG/A/M:Alk. Phos. STAR87A 1 mg C E WB
Goat anti Mouse IgG/A/M:HRP (Human Adsorbed) STAR87P 1 mg E
Rabbit F(ab')2 anti Mouse IgG:Dylight®800 STAR8D800GA 0.1 mg F IF WB
Rabbit F(ab')2 anti Mouse IgG:FITC STAR9B 1 mg F

Useful Reagents Available

Description Product Code Pack Size Applications List Price Quantity
Histar Detection System STAR3000B 150 Tests C P

Product Specific References

References for Activin Beta antibody

  1. Mellor, S.L. et al. (2000) Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.
    J Clin Endocrinol Metab. 85 (12): 4851-8.
  2. Mellor, S.L. et al. (2003) Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.
    Endocrinology. 144 (10): 4410-9.
  3. Gold, E.J. et al. (2005) betaA- and betaC-activin, follistatin, activin receptor mRNA and betaC-activin peptide expression during rat liver regeneration.
    J Mol Endocrinol. 34 (2): 505-15.