Vimentin Antibody | AbD08866

Vimentin Antibody | AbD08866 gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

  • Vimentin Antibody | AbD08866 thumbnail image 1
  • Human anti Human Vimentin
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
  • Isotype
    HuCAL Fab bivalent
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA111C, E, Pdatasheet pdfdatasheet pdf0.1 mg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • Human anti Human Vimentin antibody, clone 8866 recognizes human vimentin, a class III intermediate filament of 54kD. Vimentin is preferentially expressed in mesenchymal tissues, and within the immune system is retained throughout T-cell development, with decreasing expression in B lymphocytes with maturation.

      In lymphatic tissues vimentin expression is seen in marginal zone areas, but not in follicle centers. A lack of vimentin expression in B cell lymphoma is indicative of follicular center origin.
    • Intended Use
    • Target Species
    • Product Form
      A bivalent human recombinant Fab selected from the HuCAL ® GOLD phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
    • Reconstitution
      Reconstitute with 1.0ml distilled water
      Care should be taken during reconstitution as the protein may appear as a film at the bottom of the vial. Bio-Rad recommend that the vial is gently mixed after reconstitution.
    • Preparation
      Metal chelate affinity chromatography
    • Preservative Stabilisers
      0.09% Sodium Azide (NaN3)
      1% Bovine Serum Albumin
    • Immunogen
      Formalin fixed, parafin-embedded human lymphoma tissue
    • Purity
    • Approx. Protein Concentrations
      Antibody concentration 0.1mg/ml following reconstitution
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
    • Storage
      Prior to reconstitution store at +4oC.
      After reconstitution store at -20oC.
      Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      12 months from date of reconstitution.
    • UniProt
    • Entrez Gene
    • Acknowledgements
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Immunohistology - Frozen
      Immunohistology - Paraffin1/501/200

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • ELISA
      Due to the presence of bovine serum albumin (BSA), this antibody is unsuitable for use as a capture reagent in sandwich ELISA applications. This product is also available without BSA, please enquire.
    • Immunohistology
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional Vimentin Antibody Formats

    Formats Clone Applications Sizes available
    Vimentin Antibody : Purified AbD08866 C, E, P 0.1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Mouse anti c-Myc:HRPMCA2200P0.1 mgC, E, P, WB*
      Mouse anti Strep-Tag Classic:HRPMCA2489P75 µlE, WB

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls


              Write your review

              You may also be interested in...