Vimentin Antibody | 8866

//www.bio-rad-antibodies.com/human-vimentin-antibody-8866-hca111.html?RenderPageSpecific=1
Vimentin Antibody | 8866 gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

Enlarge
  • Vimentin Antibody | 8866 thumbnail image 1
  • Human anti Human Vimentin
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
    8866
  • Isotype
    HuCAL Fab bivalent
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA111C, E, Pdatasheet pdfdatasheet pdf0.1 mg
    HCA111
    Summary
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    References
    Reviews
    -
    • Human anti Human Vimentin antibody, clone 8866 recognizes human vimentin, a class III intermediate filament of 54kD. Vimentin is preferentially expressed in mesenchymal tissues, and within the immune system is retained throughout T-cell development, with decreasing expression in B lymphocytes with maturation.

      In lymphatic tissues vimentin expression is seen in marginal zone areas, but not in follicle centers. A lack of vimentin expression in B cell lymphoma is indicative of follicular center origin.
    • Intended Use
    • Target Species
      Human
    • Product Form
      A bivalent human recombinant Fab selected from the HuCAL ® GOLD phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
    • Reconstitution
      Reconstitute with 1.0ml distilled water
      Care should be taken during reconstitution as the protein may appear as a film at the bottom of the vial. Bio-Rad recommend that the vial is gently mixed after reconstitution.
    • Preparation
      Metal chelate affinity chromatography
    • Preservative Stabilisers
      0.09% Sodium Azide (NaN3)
      1% Bovine Serum Albumin
    • Immunogen
      Formalin fixed, parafin-embedded human lymphoma tissue
    • Purity
    • Approx. Protein Concentrations
      Antibody concentration 0.1mg/ml following reconstitution
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
    • Storage
      Prior to reconstitution store at +4oC.
      After reconstitution store at -20oC.
      Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      12 months from date of reconstitution.
    • UniProt
    • Entrez Gene
    • Acknowledgements
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      ELISA
      Immunohistology - Frozen
      Immunohistology - Paraffin1/501/200

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • ELISA
      Due to the presence of bovine serum albumin (BSA), this antibody is unsuitable for use as a capture reagent in sandwich ELISA applications. This product is also available without BSA, please enquire.
    • Immunohistology
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional Vimentin Antibody Formats

    Formats Clone Applications Sizes available
    Vimentin Antibody : Purified 8866 C, E, P 0.1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Mouse anti c-Myc:HRPMCA2200P0.1 mgC, E, P, WB*
      MCA2200P
      Mouse anti Strep-Tag Classic:HRPMCA2489P75 µlE, WB
      MCA2489P

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              References

              Write your review

               
              No experiment is complete without all the pieces

              You may also be interested in...