100% secure
Email this product page
Print this page

IL-21 Receptor Antibody

IL-21 Receptor Antibody gallery image 1

Staining of paraffin embedded human lung with Goat anti human interleukin-21 receptor (N-terminal) (AHP1819)

  • IL-21 Receptor Antibody thumbnail image 1
  • Goat anti Human Interleukin-21 Receptor (N-Terminal)
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Polyclonal Antibody
  • Isotype
    Polyclonal IgG
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    AHP1819E, Pdatasheet pdfdatasheet pdf0.1 mg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • Rabbit anti Human interleukin-21 receptor antibody recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21.

      Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.
    • Intended Use
    • Target Species
    • Product Form
      Purified IgG - liquid
    • Reconstitution
    • Preparation
    • Antiserum Preparation
      Antiserum to human IL-21R (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
    • Preservative Stabilisers
      0.1% Sodium Azide (NaN3)
      0.1% Bovine Serum Albumin
    • Immunogen
      Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R.
    • Purity
    • Approx. Protein Concentrations
      IgG concentration 1.0mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
    • Storage
      Store at -20oC only.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      18 months from date of despatch.
    • GO Terms
      interleukin-21 receptor activity
      natural killer cell activation
      integral to membrane
    • UniProt
    • Entrez Gene
    • Acknowledgements
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Immunohistology - Paraffin1/150

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
    • Recommended Protocol
    • ELISA
      This product is suitable for use in indirect ELISA applications.
    • Immunohistology
    • Histology Positive Control Tissue
      Human lung or tonsil.
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional IL-21 Receptor Antibody Formats

    Formats Applications Sizes available
    IL-21 Receptor Antibody : Purified E, P 0.1 mg
    • Copyright © 2016 Bio-Rad

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Rabbit anti Goat IgG (Fc):FITCSTAR122F1 mgF
      Rabbit anti Goat IgG (Fc):HRPSTAR122P1 mgC, E, WB

      Recommended Negative Isotype Control

        Useful Reagents

          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Antigen Retrieval Buffer, pH8.0BUF025C50 mlP
          Antigen Retrieval Buffer, pH8.0BUF025A500 mlP

          Recommended Positive Controls

            Histology Controls

              Human lung or tonsil.
                • Product Images

                • IL-21 Receptor Antibody thumbnail image 1

              Write your review

              You may also be interested in...