GDF9 Antibody | mAb-GDF9-53

GDF9 Antibody | mAb-GDF9-53 gallery image 1

GDF9 over expressing lysate probed with Mouse anti Human GDF9 (MCA5635GA)

  • GDF9 Antibody | mAb-GDF9-53 thumbnail image 1
  • Mouse anti Human GDF9
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
  • Isotype
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    MCA5635GAC, FN, P *, WBdatasheet pdfdatasheet pdf0.1 mg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • Mouse anti Human GDF9 antibody, clone mAb-GDF9-53 recognizes an epitope within the highly conserved EPDG sequence of GDF9 (growth differentiation factor 9), a 454 amino acid ~51 kDa pro-protein which is cleaved to form a ~17.5 kDa GDF9 monomer which self associates to form an active homodimeric growth factor, a member of the TGF-beta superfamily, closely related to bone morphogenetic proteins (BMPs).

      GDF9 is expressed by oocytes, playing a vital role in ovarian folliculogenesis, normal follicle development, and fertility. GDF9 signals through binding to bone morphogenetic protein type II receptor (BMPRII), and apparent subsequent activation of TGF-beta type I receptor, otherwise known as activin receptor-like kinase-5 (ALK-5).

      Mouse anti Human GDF9 antibody, clone mAb-GDF9-53 recognises GDF9 with high immuno-affinity, and has been shown to neutralize GDF9 biological activity (Gilchrist et al. 2004, Dragovic et al. 2005).

      Removal of sodium azide is recommended prior to use in functional assays – Bio-Rad recommend the use of EQU003 for this purpose.
    • Intended Use
    • Target Species
    • Species Cross-Reactivity
      Target SpeciesCross Reactivity
      N.B. Antibody reactivity and working conditions may vary between species.
    • Product Form
      Purified IgG - liquid
    • Reconstitution
    • Preparation
      Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
    • Preservative Stabilisers
      0.09% Sodium Azide (NaN3)
    • Immunogen
      Tuberculin coupled synthetic peptide VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from near the C-terminal region of mature human GDF9.
    • Purity
    • Approx. Protein Concentrations
      IgG concentration 1.0mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
    • Fusion Partners
      Spleen cells from immunised Balb/c mice were fused with cells of the SP2/0 myeloma cell line.
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      18 months from date of despatch.
    • GO Terms
      negative regulation of cell growth
      oocyte growth
      transforming growth factor beta receptor signaling pathway
      growth factor activity
      extracellular space
      cytokine activity
    • UniProt
    • Entrez Gene
    • Acknowledgements
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Functional Assays
      Immunohistology - Frozen
      Western Blotting1/1001/1000
      Immunohistology - Paraffin(1)1/251/100
      This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
    • Recommended Protocol
    • ELISA
    • Immunohistology
    • Histology Positive Control Tissue
      Human ovary
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional GDF9 Antibody Formats

    Formats Clone Applications Sizes available
    GDF9 Antibody : Purified mAb-GDF9-53 C, FN, P *, WB 0.1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed)STAR117A0.5 mgE, WB
      Goat anti Mouse IgG/A/M:Alk. Phos.STAR87A1 mgC, E, WB
      Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed)STAR117D488GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed)STAR117D549GA0.1 mgF, IF, WB
      Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed)STAR117D649GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed)STAR117D680GA0.1 mgF, WB
      Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed)STAR117D800GA0.1 mgF, IF, WB
      Rabbit F(ab')2 anti Mouse IgG:Dylight®800STAR8D800GA0.1 mgF, IF, WB
      Human anti Mouse IgG2a:FITCHCA037F0.1 mgF
      Human anti Mouse IgG2b:FITCHCA038F0.1 mgF
      Human anti Mouse IgG3:FITCHCA039F0.1 mgF
      Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed)STAR117F0.5 mgF
      Goat anti Mouse IgG:FITC (Rat Adsorbed)STAR700.5 mgF
      Goat anti Mouse IgG (Fc):FITCSTAR120F1 mgC, F
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      Human anti Mouse IgG1:HRPHCA036P0.1 mgE
      Human anti Mouse IgG2a:HRPHCA037P0.1 mgE
      Human anti Mouse IgG2b:HRPHCA038P0.1 mgE
      Human anti Mouse IgG3:HRPHCA039P0.1 mgE
      Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed)STAR117P0.5 mgE, WB
      Goat anti Mouse IgG:HRP (Rat Adsorbed)STAR770.5 mgC, E, P
      Goat anti Mouse IgG (Fc):HRPSTAR120P1 mgE, WB
      Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed)STAR13B1 mgC, E, P, RE, WB
      Goat anti Mouse IgG/A/M:HRP (Human Adsorbed)STAR87P1 mgE
      Rabbit F(ab')2 anti Mouse IgG:RPESTAR12A1 mlF
      Goat anti Mouse IgG:RPE (Rat Adsorbed)STAR761 mlF
      Human anti Mouse IgG3:RPEHCA039PE100 TestsF

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              Human ovary
              • Application NameReference Images
                Functional Assays
                Western Blotting


              Write your review

              • View more products with "GDF9" specificity.

              You may also be interested in...