CD81 Antibody | 8864

CD81 Antibody | 8864 gallery image 1

Staining of human peripheral blood lymphocytes with Human anti Human CD81 (HCA113)

  • CD81 Antibody | 8864 thumbnail image 1
  • Human anti Human CD81
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
  • Isotype
    HuCAL Fab bivalent
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA113E, Fdatasheet pdfdatasheet pdf0.1 mg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • Human anti Human CD81 antibody, clone 8864 specifically recognizes human CD81, which is a 26kDa member of the TM4SF tetraspanin family. In humans, CD81 is widely expressed on most tissues with T-cells having the highest level of expression, followed by monocytes and B-cells. Levels of CD81 expression are increased after activation.

      CD81 has the ability to interact with a wide range of proteins and plays an important role in a variety of leucocyte functions including activation, proliferation and differentiation. In recent studies, the CD81 molecule has been identified as the putative receptor for the Hepatitis C Virus envelope E2 glycoprotein and is vital for HCV entry into hepatic cells.
    • Intended Use
    • Target Species
    • Product Form
      A bivalent human recombinant Fab selected from the HuCAL ® phage display library, expressed in E.Coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
    • Reconstitution
    • Preparation
      StrepTactin affinity chromatography
    • Preservative Stabilisers
      0.01% Thiomersal
    • Immunogen
      Recombinant human CD81.
    • Purity
    • Approx. Protein Concentrations
      Total protein concentration 0.5mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      12 months from date of despatch.
    • GO Terms
      cell proliferation
      positive regulation of cell proliferation
      integral to plasma membrane
      phosphatidylinositol biosynthetic process
      positive regulation of peptidyl-tyrosine phosphorylation
      activation of MAPK activity
      protein binding
      virion attachment, binding of host cell surface receptor
      protein localization
      regulation of immune response
      positive regulation of 1-phosphatidylinositol 4-kinase activity
    • UniProt
    • Entrez Gene
    • Acknowledgements
      Sold under license of U.S. Patents 6,300,064, 6,696,248, 6,708,484, 6,753,136, European patent 0,859,841 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Flow CytometryNeat1/50

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • ELISA
    • Immunohistology
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional CD81 Antibody Formats

    Formats Clone Applications Sizes available
    CD81 Antibody : Purified 8864 E, F 0.1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      Mouse anti Strep-Tag ImmoMCA24880.1 mgE

      Recommended Negative Isotype Control

        DescriptionProduct CodePack SizeApplicationsList PriceQuantity
        HuCAL Fab-dHLX-MSx2 Negative ControlHCA1020.1 mgC, E, F, P, WB

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              Write your review

              You may also be interested in...