CD81 Antibody | 8863

//www.bio-rad-antibodies.com/human-cd81-antibody-8863-hca112.html?RenderPageSpecific=1
CD81 Antibody | 8863 gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

Enlarge
  • CD81 Antibody | 8863 thumbnail image 1
  • Human anti Human CD81
  • Human anti Human CD81
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
    8863
  • Isotype
    HuCAL Fab bivalent
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA112E, Fdatasheet pdfdatasheet pdf0.1 mg
    HCA112
    HCA112AE, Fdatasheet pdfdatasheet pdf50 µg
    HCA112A
    Summary
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    References
    Reviews
    -
    • Human anti Human CD81 antibody, clone 8863 specifically recognizes human CD81, which is a 26kDa member of the TM4SF tetraspanin family. In humans, CD81 is widely expressed on most tissues with T-cells having the highest level of expression, followed by monocytes and B-cells. Levels of CD81 expression are increased after activation.

      CD81 has the ability to interact with a wide range of proteins and plays an important role in a variety of leucocyte functions including activation, proliferation and differentiation. In recent studies, the CD81 molecule has been identified as the putative receptor for the Hepatitis C Virus envelope E2 glycoprotein and is vital for HCV entry into hepatic cells.
    • Intended Use
    • Target Species
      Human
    • Product Form
      A bivalent human recombinant Fab selected from the HuCAL ® phage display library, expressed in E.Coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
      A bivalent human recombinant Fab selected from the HuCAL ® phage display library, expressed in E.Coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
    • Reconstitution
      Pack Size: 50 µgReconstitute with 0.5ml distilled water
      Pack Size: 50 µgReconstitute with 0.5ml distilled water
    • Preparation
      StrepTactin affinity chromatography
      StrepTactin affinity chromatography
    • Preservative Stabilisers
      Pack Size: 0.1 mg0.01% Thiomersal
      Pack Size: 50 µg0.09% Sodium Azide (NaN3)
      1% Bovine Serum Albumin
      Pack Size: 0.1 mg0.01% Thiomersal
      Pack Size: 50 µg0.09% Sodium Azide (NaN3)
      1% Bovine Serum Albumin
    • Immunogen
      Recombinant human CD81
    • Purity
    • Approx. Protein Concentrations
      Pack Size: 0.1 mgTotal protein concentration 0.5 mg/ml
      Pack Size: 50 µgTotal protein concentration 0.1mg/ml
      Pack Size: 0.1 mgTotal protein concentration 0.5 mg/ml
      Pack Size: 50 µgTotal protein concentration 0.1mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
      Phosphate buffered saline
    • Storage
      Pack Size: 0.1 mgStore at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Pack Size: 50 µgPrior to reconstitution store at +4oC.
      After reconstitution store at -20oC.
      Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Pack Size: 0.1 mgStore at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Pack Size: 50 µgPrior to reconstitution store at +4oC.
      After reconstitution store at -20oC.
      Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      12 months from date of despatch.
      12 months from date of reconstitution.
    • GO Terms
      activation of MAPK activity
      regulation of immune response
      positive regulation of 1-phosphatidylinositol 4-kinase activity
      positive regulation of peptidyl-tyrosine phosphorylation
      protein localization
      positive regulation of cell proliferation
      phosphatidylinositol biosynthetic process
      virion attachment, binding of host cell surface receptor
      integral to plasma membrane
      cell proliferation
      protein binding
    • UniProt
    • Entrez Gene
    • Acknowledgements
      Sold under license of U.S. Patents 6,300,064, 6,696,248, 6,708,484, 6,753,136, European patent 0,859,841 and corresponding patents.
      Sold under license of U.S. Patents 6,300,064, 6,696,248, 6,708,484, 6,753,136, European patent 0,859,841 and corresponding patents.
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      ELISA
      Flow CytometryNeat1/10
    • Application NameYesNoMin DilutionMax Dilution
      ELISA
      Flow CytometryNeat1/10

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • Recommended Protocol
    • ELISA
    • ELISA
      Due to the presence of bovine serum albumin (BSA), this antibody is unsuitable for use as a capture reagent in sandwich ELISA applications. This product is also available without BSA, please enquire.
    • Immunohistology
    • Immunohistology
    • Histology Positive Control Tissue
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Immunofluorescence
    • Western Blotting
    • Western Blotting
    • Instructions For Use
    • Instructions For Use

    Additional CD81 Antibody Formats

    Formats Clone Applications Sizes available
    CD81 Antibody : Purified 8863 E, F 50 µg | 0.1 mg
    • Copyright © 2016 Bio-Rad

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      STAR9B
      Mouse anti Strep-Tag ImmoMCA24880.1 mgE
      MCA2488
      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      STAR9B
      Mouse anti Strep-Tag ImmoMCA24880.1 mgE
      MCA2488

      Recommended Negative Isotype Control

        DescriptionProduct CodePack SizeApplicationsList PriceQuantity
        HuCAL Fab-dHLX-MSx2 Negative ControlHCA1020.1 mgC, E, F, P, WB
        HCA102
        DescriptionProduct CodePack SizeApplicationsList PriceQuantity
        HuCAL Fab-dHLX-MSx2 Negative ControlHCA102A50 µgC, E, F, P, WB
        HCA102A

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              Write your review

              You may also be interested in...