Activin Beta Antibody | betaC clone 1

Activin Beta Antibody | betaC clone 1 gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

  • Activin Beta Antibody | betaC clone 1 thumbnail image 1
  • Mouse anti Human Activin BetaC-Subunit
  • Mouse anti Human Activin BetaC-Subunit
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
    betaC clone 1
  • Isotype
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    MCA2535GAE, P *, WBdatasheet pdfdatasheet pdf0.1 mg
    MCA2535GBE, P *, WBdatasheet pdfdatasheet pdf50 µg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • Mouse anti Human Activin betaC-subunit antibody, clone 1 recognizes the BetaC-subunit of Activin (BetaC-activin), a member of the transforming growth factor beta (TGF-beta) superfamily and one of a group of proteins which regulate growth and differentiation in a range of cells and tissues, via both autocrine and paracrine pathways.

      Activins were originally characterised by the formation of specific homo- and heterodimers of activin BetaA- or BetaB-subunits, but additional subunits of activin have since been identified including BetaC, BetaD and BetaE. BetaC-activin, expressed in the liver, prostrate, ovary and testis, has been shown to exhibit both growth promoting and inhibitory properties, and evidence suggests that BetaC-activin can form BetaC homodimers and also heterodimers with BetaA (putative activin AC) and BetaB (putative activin BC).

      Clone betaC clone 1 has been shown to recognize both monomeric and dimeric BetaC-activin and does not cross react with BetaA, BetaB or BetaE.
    • Intended Use
    • Target Species
    • Species Cross-Reactivity
      Target SpeciesCross Reactivity
      N.B. Antibody reactivity and working conditions may vary between species.
    • Product Form
      Purified IgG - liquid
      Purified IgG - liquid
    • Reconstitution
    • Preparation
      Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
      Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
    • Preservative Stabilisers
      0.09% Sodium Azide (NaN3)
      0.09% Sodium Azide (NaN3)
    • Immunogen
      Synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit.
    • Purity
    • Approx. Protein Concentrations
      IgG concentration 0.5mg/ml
      IgG concentration 0.5mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
      Phosphate buffered saline
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      18 months from date of despatch.
      18 months from date of despatch.
    • GO Terms
      transforming growth factor beta receptor binding
      hormone activity
      growth factor activity
      extracellular region
    • UniProt
    • Entrez Gene
    • Acknowledgements
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Western Blotting1/5000
      Immunohistology - Paraffin(1)
      This product requires antigen retrieval using heat treatment prior to staining of paraffin sections, 0.01 mol/L glycine buffer solution (pH 4.4) is recommended for this purpose. See Mellor et al. for details.
    • Application NameYesNoMin DilutionMax Dilution
      Western Blotting1/5000
      Immunohistology - Paraffin(1)
      This product requires antigen retrieval using heat treatment prior to staining of paraffin sections, 0.01 mol/L glycine buffer solution (pH 4.4) is recommended for this purpose. See Mellor et al. for details.

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
    • Technical Advice
    • Recommended Protocol
    • Recommended Protocol
    • ELISA
    • ELISA
    • Immunohistology
    • Immunohistology
    • Histology Positive Control Tissue
      Liver. Staining localises to hepatocytes.
    • Histology Positive Control Tissue
      Liver. Staining localises to hepatocytes.
    • Immunofluorescence
    • Immunofluorescence
    • Western Blotting
    • Western Blotting
    • Instructions For Use
    • Instructions For Use

    Additional Activin Beta Antibody Formats

    Formats Clone Applications Sizes available
    Activin Beta Antibody : Purified betaC clone 1 E, P *, WB 50 µg | 0.1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed)STAR117A0.5 mgE, WB
      Goat anti Mouse IgG/A/M:Alk. Phos.STAR87A1 mgC, E, WB
      Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed)STAR117D488GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed)STAR117D549GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed)STAR117D649GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed)STAR117D680GA0.1 mgF, WB
      Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed)STAR117D800GA0.1 mgF, IF, WB
      Rabbit F(ab')2 anti Mouse IgG:Dylight®800STAR8D800GA0.1 mgF, IF, WB
      Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed)STAR117F0.5 mgF
      Goat anti Mouse IgG:FITC (Rat Adsorbed)STAR700.5 mgF
      Goat anti Mouse IgG (Fc):FITCSTAR120F1 mgC, F
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      Human anti Mouse IgG1:HRPHCA036P0.1 mgE
      Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed)STAR117P0.5 mgE, WB
      Goat anti Mouse IgG:HRP (Rat Adsorbed)STAR770.5 mgC, E, P
      Goat anti Mouse IgG (Fc):HRPSTAR120P1 mgE, WB
      Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed)STAR13B1 mgC, E, P, RE, WB
      Goat anti Mouse IgG/A/M:HRP (Human Adsorbed)STAR87P1 mgE
      Rabbit F(ab')2 anti Mouse IgG:RPESTAR12A1 mlF
      Goat anti Mouse IgG:RPE (Rat Adsorbed)STAR761 mlF
      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed)STAR117A0.5 mgE, WB
      Goat anti Mouse IgG/A/M:Alk. Phos.STAR87A1 mgC, E, WB
      Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed)STAR117D488GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed)STAR117D549GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed)STAR117D649GA0.1 mgF, IF
      Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed)STAR117D680GA0.1 mgF, WB
      Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed)STAR117D800GA0.1 mgF, IF, WB
      Rabbit F(ab')2 anti Mouse IgG:Dylight®800STAR8D800GA0.1 mgF, IF, WB
      Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed)STAR117F0.5 mgF
      Goat anti Mouse IgG:FITC (Rat Adsorbed)STAR700.5 mgF
      Goat anti Mouse IgG (Fc):FITCSTAR120F1 mgC, F
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      Human anti Mouse IgG1:HRPHCA036P0.1 mgE
      Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed)STAR117P0.5 mgE, WB
      Goat anti Mouse IgG:HRP (Rat Adsorbed)STAR770.5 mgC, E, P
      Goat anti Mouse IgG (Fc):HRPSTAR120P1 mgE, WB
      Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed)STAR13B1 mgC, E, P, RE, WB
      Goat anti Mouse IgG/A/M:HRP (Human Adsorbed)STAR87P1 mgE
      Rabbit F(ab')2 anti Mouse IgG:RPESTAR12A1 mlF
      Goat anti Mouse IgG:RPE (Rat Adsorbed)STAR761 mlF

      Recommended Negative Isotype Control

        Useful Reagents

          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Histar Detection SystemSTAR3000B150 TestsC, P
          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Histar Detection SystemSTAR3000B150 TestsC, P

          Recommended Positive Controls

            Histology Controls

              Liver. Staining localises to hepatocytes.
              Liver. Staining localises to hepatocytes.


              Write your review


              You may also be interested in...