Activin Beta Antibody | betaC clone 1

//www.bio-rad-antibodies.com/human-activin-beta-antibody-betac-clone-1-mca2535ga.html?RenderPageSpecific=1
Activin Beta Antibody | betaC clone 1 gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

Enlarge
  • Activin Beta Antibody | betaC clone 1 thumbnail image 1
  • Mouse anti Human Activin BetaC-Subunit
  • Mouse anti Human Activin BetaC-Subunit
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
    betaC clone 1
  • Isotype
    IgG1
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    MCA2535GAE, P *, WBdatasheet pdfdatasheet pdf0.1 mg
    MCA2535GA
    MCA2535GBE, P *, WBdatasheet pdfdatasheet pdf50 µg
    MCA2535GB
    Summary
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    References
    Reviews
    -
    • Mouse anti Human Activin betaC-subunit antibody, clone 1 recognizes the BetaC-subunit of Activin (BetaC-activin), a member of the transforming growth factor beta (TGF-beta) superfamily and one of a group of proteins which regulate growth and differentiation in a range of cells and tissues, via both autocrine and paracrine pathways.

      Activins were originally characterised by the formation of specific homo- and heterodimers of activin BetaA- or BetaB-subunits, but additional subunits of activin have since been identified including BetaC, BetaD and BetaE. BetaC-activin, expressed in the liver, prostrate, ovary and testis, has been shown to exhibit both growth promoting and inhibitory properties, and evidence suggests that BetaC-activin can form BetaC homodimers and also heterodimers with BetaA (putative activin AC) and BetaB (putative activin BC).

      Clone betaC clone 1 has been shown to recognize both monomeric and dimeric BetaC-activin and does not cross react with BetaA, BetaB or BetaE.
    • Intended Use
    • Target Species
      Human
    • Species Cross-Reactivity
      Target SpeciesCross Reactivity
      Ratyes
      N.B. Antibody reactivity and working conditions may vary between species.
    • Product Form
      Purified IgG - liquid
      Purified IgG - liquid
    • Reconstitution
    • Preparation
      Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
      Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
    • Preservative Stabilisers
      0.09% Sodium Azide (NaN3)
      0.09% Sodium Azide (NaN3)
    • Immunogen
      Synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit.
    • Purity
    • Approx. Protein Concentrations
      IgG concentration 0.5mg/ml
      IgG concentration 0.5mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
      Phosphate buffered saline
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      18 months from date of despatch.
      18 months from date of despatch.
    • GO Terms
      transforming growth factor beta receptor binding
      growth
      hormone activity
      growth factor activity
      extracellular region
    • UniProt
    • Entrez Gene
    • Acknowledgements
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      ELISA
      Western Blotting1/5000
      Immunohistology - Paraffin(1)
      (1)
      This product requires antigen retrieval using heat treatment prior to staining of paraffin sections, 0.01 mol/L glycine buffer solution (pH 4.4) is recommended for this purpose. See Mellor et al. for details.
    • Application NameYesNoMin DilutionMax Dilution
      ELISA
      Western Blotting1/5000
      Immunohistology - Paraffin(1)
      (1)
      This product requires antigen retrieval using heat treatment prior to staining of paraffin sections, 0.01 mol/L glycine buffer solution (pH 4.4) is recommended for this purpose. See Mellor et al. for details.

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
    • Technical Advice
    • Recommended Protocol
    • Recommended Protocol
    • ELISA
    • ELISA
    • Immunohistology
    • Immunohistology
    • Histology Positive Control Tissue
      Liver. Staining localises to hepatocytes.
    • Histology Positive Control Tissue
      Liver. Staining localises to hepatocytes.
    • Immunofluorescence
    • Immunofluorescence
    • Western Blotting
    • Western Blotting
    • Instructions For Use
    • Instructions For Use

    Additional Activin Beta Antibody Formats

    Formats Clone Applications Sizes available
    Activin Beta Antibody : Purified betaC clone 1 E, P *, WB 50 µg | 0.1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed)STAR117A0.5 mgE, WB
      STAR117A
      Goat anti Mouse IgG/A/M:Alk. Phos.STAR87A1 mgC, E, WB
      STAR87A
      Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed)STAR117D488GA0.1 mgF, IF
      STAR117D488GA
      Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed)STAR117D549GA0.1 mgF, IF
      STAR117D549GA
      Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed)STAR117D649GA0.1 mgF, IF
      STAR117D649GA
      Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed)STAR117D680GA0.1 mgF, WB
      STAR117D680GA
      Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed)STAR117D800GA0.1 mgF, IF, WB
      STAR117D800GA
      Rabbit F(ab')2 anti Mouse IgG:Dylight®800STAR8D800GA0.1 mgF, IF, WB
      STAR8D800GA
      Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed)STAR117F0.5 mgF
      STAR117F
      Goat anti Mouse IgG:FITC (Rat Adsorbed)STAR700.5 mgF
      STAR70
      Goat anti Mouse IgG (Fc):FITCSTAR120F1 mgC, F
      STAR120F
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      STAR9B
      Human anti Mouse IgG1:HRPHCA036P0.1 mgE
      HCA036P
      Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed)STAR117P0.5 mgE, WB
      STAR117P
      Goat anti Mouse IgG:HRP (Rat Adsorbed)STAR770.5 mgC, E, P
      STAR77
      Goat anti Mouse IgG (Fc):HRPSTAR120P1 mgE, WB
      STAR120P
      Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed)STAR13B1 mgC, E, P, RE, WB
      STAR13B
      Goat anti Mouse IgG/A/M:HRP (Human Adsorbed)STAR87P1 mgE
      STAR87P
      Rabbit F(ab')2 anti Mouse IgG:RPESTAR12A1 mlF
      STAR12A
      Goat anti Mouse IgG:RPE (Rat Adsorbed)STAR761 mlF
      STAR76
      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Goat anti Mouse IgG (H/L):Alk. Phos. (Multi Species Adsorbed)STAR117A0.5 mgE, WB
      STAR117A
      Goat anti Mouse IgG/A/M:Alk. Phos.STAR87A1 mgC, E, WB
      STAR87A
      Goat anti Mouse IgG (H/L):DyLight®488 (Multi Species Adsorbed)STAR117D488GA0.1 mgF, IF
      STAR117D488GA
      Goat anti Mouse IgG (H/L):DyLight®549 (Multi Species Adsorbed)STAR117D549GA0.1 mgF, IF
      STAR117D549GA
      Goat anti Mouse IgG (H/L):DyLight®649 (Multi Species Adsorbed)STAR117D649GA0.1 mgF, IF
      STAR117D649GA
      Goat anti Mouse IgG (H/L):DyLight®680 (Multi Species Adsorbed)STAR117D680GA0.1 mgF, WB
      STAR117D680GA
      Goat anti Mouse IgG (H/L):DyLight®800 (Multi Species Adsorbed)STAR117D800GA0.1 mgF, IF, WB
      STAR117D800GA
      Rabbit F(ab')2 anti Mouse IgG:Dylight®800STAR8D800GA0.1 mgF, IF, WB
      STAR8D800GA
      Goat anti Mouse IgG (H/L):FITC (Multi Species Adsorbed)STAR117F0.5 mgF
      STAR117F
      Goat anti Mouse IgG:FITC (Rat Adsorbed)STAR700.5 mgF
      STAR70
      Goat anti Mouse IgG (Fc):FITCSTAR120F1 mgC, F
      STAR120F
      Rabbit F(ab')2 anti Mouse IgG:FITCSTAR9B1 mgF
      STAR9B
      Human anti Mouse IgG1:HRPHCA036P0.1 mgE
      HCA036P
      Goat anti Mouse IgG (H/L):HRP (Multi Species Adsorbed)STAR117P0.5 mgE, WB
      STAR117P
      Goat anti Mouse IgG:HRP (Rat Adsorbed)STAR770.5 mgC, E, P
      STAR77
      Goat anti Mouse IgG (Fc):HRPSTAR120P1 mgE, WB
      STAR120P
      Rabbit F(ab')2 anti Mouse IgG:HRP (Human Adsorbed)STAR13B1 mgC, E, P, RE, WB
      STAR13B
      Goat anti Mouse IgG/A/M:HRP (Human Adsorbed)STAR87P1 mgE
      STAR87P
      Rabbit F(ab')2 anti Mouse IgG:RPESTAR12A1 mlF
      STAR12A
      Goat anti Mouse IgG:RPE (Rat Adsorbed)STAR761 mlF
      STAR76

      Recommended Negative Isotype Control

        Useful Reagents

          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Histar Detection SystemSTAR3000B150 TestsC, P
          STAR3000B
          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Histar Detection SystemSTAR3000B150 TestsC, P
          STAR3000B

          Recommended Positive Controls

            Histology Controls

              Liver. Staining localises to hepatocytes.
              Liver. Staining localises to hepatocytes.

              References

              Write your review

               
              No experiment is complete without all the pieces

              You may also be interested in...