HuCAL Fab-dHLX-FSx2 Negative Control Antibody | 8970

HuCAL Fab-dHLX-FSx2 Negative Control Antibody | 8970 gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

  • HuCAL Fab-dHLX-FSx2 Negative Control Antibody | 8970 thumbnail image 1
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Negative/Isotype Control
  • Clone
  • Isotype
    HuCAL Fab bivalent
3 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA104A488Fdatasheet pdfdatasheet pdf100 Tests/1ml
    HCA104A647Fdatasheet pdfdatasheet pdf100 Tests/1ml
    HCA104AC, E, F, P, WBdatasheet pdfdatasheet pdf50 µg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • HCA104A is a recombinant antibody with specificity for Green Fluorescent Protein. It has no known reactivity with mammalian proteins or other antigens. It is therefore recommended as a negative control reagent when using other HuCAL antibodies of the same format. It is recommended that this reagent is used at the same concentration as the test reagent.
    • Intended Use
    • Target Species
      Negative Control
    • Product Form
      A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
      A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid and conjugated to Alexa Fluor®488.
      A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid and conjugated to Alexa Fluor®647.
    • Reconstitution
    • Preparation
      StrepTactin affinity chromatography
      StrepTactin affinity chromatography
      StrepTactin affinity chromatography
    • Preservative Stabilisers
      0.01% Thiomersal
      0.09% Sodium Azide (NaN3)
      1% Bovine Serum Albumin
      0.09% Sodium Azide (NaN3)
      1% Bovine Serum Albumin
    • Immunogen
      Green fluorescent protein
    • Purity
    • Approx. Protein Concentrations
      Total protein concentration 0.5 mg/ml
      Antibody concentration 0.05mg/ml
      Antibody concentration 0.05mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
      Phosphate buffered saline
      Phosphate buffered saline
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. This product is photosensitive and should be protected from light.
      Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. This product is photosensitive and should be protected from light.
      Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      12 months from date of despatch.
      12 months from date of despatch.
      12 months from date of despatch.
    • Acknowledgements
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents.
      This product is provided under an intellectual property licence from Life Technologies Corporation. The transfer of this product is contingent on the buyer using the purchase product solely in research, excluding contract research or any fee for service research, and the buyer must not sell or otherwise transfer this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; (c) manufacturing or quality assurance or quality control, or (d) resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad CA 92008 USA or
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents.
      This product is provided under an intellectual property licence from Life Technologies Corporation. The transfer of this product is contingent on the buyer using the purchase product solely in research, excluding contract research or any fee for service research, and the buyer must not sell or otherwise transfer this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; (c) manufacturing or quality assurance or quality control, or (d) resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad CA 92008 USA or
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Flow Cytometry
      Immunohistology - Frozen
      Immunohistology - Paraffin
      Western Blotting
    • Application NameYesNoMin DilutionMax Dilution
      Flow Cytometry
    • Application NameYesNoMin DilutionMax Dilution
      Flow Cytometry

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • Recommended Protocol
    • Recommended Protocol
    • ELISA
    • ELISA
    • ELISA
    • Immunohistology
    • Immunohistology
    • Immunohistology
    • Histology Positive Control Tissue
    • Histology Positive Control Tissue
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Immunofluorescence
    • Immunofluorescence
    • Western Blotting
    • Western Blotting
    • Western Blotting
    • Instructions For Use
    • Instructions For Use
    • Instructions For Use

    Additional HuCAL Fab-dHLX-FSx2 Negative Control Antibody Formats

    Formats Clone Applications Sizes available
    HuCAL Fab-dHLX-FSx2 Negative Control Antibody : Alexa Fluor® 488 8970 F 100 Tests/1ml
    HuCAL Fab-dHLX-FSx2 Negative Control Antibody : Alexa Fluor® 647 8970 F 100 Tests/1ml
    HuCAL Fab-dHLX-FSx2 Negative Control Antibody : Purified 8970 C, E, F, P, WB 50 µg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Mouse anti Strep-Tag Classic:HRPMCA2489P75 µlE, WB

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              Write your review

              You may also be interested in...