HuCAL Fab-A-V5Sx2 Negative Control Antibody | 11074

HuCAL Fab-A-V5Sx2 Negative Control Antibody | 11074 gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

  • HuCAL Fab-A-V5Sx2 Negative Control Antibody | 11074 thumbnail image 1
  • HuCAL Fab-A-V5Sx2 Negative Control
  • HuCAL Fab-A-V5Sx2 Negative Control
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Negative/Isotype Control
  • Clone
  • Isotype
    HuCAL Fab bivalent
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA148C, E, F, P, WBdatasheet pdfdatasheet pdf0.1 mg
    HCA148AC, E, F, P, WBdatasheet pdfdatasheet pdf50 µg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • HCA148 is a recombinant antibody with specificity for Green Fluorescent Protein. It has no known reactivity with mammalian proteins or other antigens. It is therefore recommended as a negative control reagent when using other HuCAL antibodies of the same format. It is recommended that this reagent is used at the same concentration as the test reagent.
    • Intended Use
    • Target Species
      Negative Control
    • Product Form
      A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied lyophilised.
      A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied lyophilised.
    • Reconstitution
      Pack Size: 0.1 mgReconstitute with 1.0ml distilled water
      Pack Size: 50 µgReconstitute with 0.5ml distilled water
      Pack Size: 0.1 mgReconstitute with 1.0ml distilled water
      Pack Size: 50 µgReconstitute with 0.5ml distilled water
    • Preparation
      StrepTactin affinity chromatography
      StrepTactin affinity chromatography
    • Preservative Stabilisers
      0.09% Sodium Azide (NaN3)
      1% Bovine Serum Albumin
      0.09% Sodium Azide (NaN3)
      1% Bovine Serum Albumin
    • Immunogen
      Green fluorescent protein
    • Purity
    • Approx. Protein Concentrations
      Total protein concentration 0.1mg/ml
      Total protein concentration 0.1mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
      Phosphate buffered saline
    • Storage
      Prior to reconstitution store at +4oC.
      After reconstitution store at -20oC.
      Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Prior to reconstitution store at +4oC.
      After reconstitution store at -20oC.
      Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      12 months from date of reconstitution.
      12 months from date of reconstitution.
    • Acknowledgements
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Flow Cytometry
      Immunohistology - Frozen
      Immunohistology - Paraffin
      Western Blotting
    • Application NameYesNoMin DilutionMax Dilution
      Flow Cytometry
      Immunohistology - Frozen
      Immunohistology - Paraffin
      Western Blotting

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • Recommended Protocol
    • ELISA
    • ELISA
    • Immunohistology
    • Immunohistology
    • Histology Positive Control Tissue
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Immunofluorescence
    • Western Blotting
    • Western Blotting
    • Instructions For Use
    • Instructions For Use

    Additional HuCAL Fab-A-V5Sx2 Negative Control Antibody Formats

    Formats Clone Applications Sizes available
    HuCAL Fab-A-V5Sx2 Negative Control Antibody : Purified 11074 C, E, F, P, WB 0.1 mg | 50 µg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Rat anti DYKDDDDK Tag:Alexa Fluor®647MCA4764A6471 mlF
      Rat anti DYKDDDDK Tag:FITCMCA4764F0.1 mgF, IF
      Rat anti DYKDDDDK Tag:HRPMCA4764P0.1 mgE, P, WB
      Mouse anti Strep-Tag Classic:HRPMCA2489P75 µlE, WB
      Rat anti DYKDDDDK TagMCA47640.2 mgE, F, IF, IP, P, WB
      Rat anti DYKDDDDK Tag:RPEMCA4764PE100 TestsF
      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Rat anti DYKDDDDK Tag:Alexa Fluor®647MCA4764A6471 mlF
      Rat anti DYKDDDDK Tag:FITCMCA4764F0.1 mgF, IF
      Rat anti DYKDDDDK Tag:HRPMCA4764P0.1 mgE, P, WB
      Mouse anti Strep-Tag Classic:HRPMCA2489P75 µlE, WB
      Rat anti DYKDDDDK TagMCA47640.2 mgE, F, IF, IP, P, WB
      Rat anti DYKDDDDK Tag:RPEMCA4764PE100 TestsF

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              Write your review

              No experiment is complete without all the pieces

              You may also be interested in...