Osteocalcin Antibody | 2591

//www.bio-rad-antibodies.com/cow-bovine-osteocalcin-antibody-2591-hca029.html?RenderPageSpecific=1
Osteocalcin Antibody | 2591 gallery image 1

Purchased this product? Why not be the first to submit a review and upload an image?

Enlarge
  • Osteocalcin Antibody | 2591 thumbnail image 1
  • Human anti Bovine Osteocalcin
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
    2591
  • Isotype
    HuCAL Fab bivalent
1 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA029E, WBdatasheet pdfdatasheet pdf50 µg
    HCA029
    Summary
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    References
    Reviews
    -
    • Human anti Bovine osteocalcin antibody, clone 2591 recognizes bovine osteocalcin (Bone Gla Protein), a 49 amino acid single chain vitamin K dependent protein (MW 5.8 kDa), made by osteoblasts and a major component of the non-collagenous bone matrix. Post-translational modification by a vitamin K dependent carboxylase produces three g-carboxyglutamic acid residues at positions 17, 21 and 24, giving it a high affinity for calcium. The mature protein contains a single intrachain disulfide bond joining Cys23 to Cys29. The secondary structure is highly calcium dependent and contains 14% a-helix, 20% ß-sheet and 67% random form in the presence of calcium, and 1% a-helix, 20% β-sheet and 79% random form in the ab-sence of calcium (Delmas et al. 1984). Sixty to ninety percent of de novo synthesized osteocalcin is incorporated into the bone matrix where it binds to hydroxy-apatite during matrix mineralization. The remainder of the osteocalcin is released into the circulation where it can be measured as a sensitive marker of bone formation. Serum osteocalcin is elevated in diseases characterized by increased bone turnover such as os-teoporosis, hyperparathyroidism and Paget’s disease, and low in conditions associated with low bone turnover such as hypoparathyroidism and growth hormone deficiency ( Lee et al. 1990). Circulating Osteocalcin is unstable as it contains a tryptic cleavage site at amino acids 43-45 near the C-terminus. After cleavage a large fragment containing amino acids 1 – 43 is formed, which contains both the N-terminus and the middle portion of the protein. Whereas the levels of intact Osteocalcin rapidly decreases, 1-43 Osteocalcin remains stable in serum even after repeated freeze thaw cycles or storage at elevated temperatures ( Lee et al. 1990 for details.
      Human anti Bovine osteocalcin antibody, clone 2591 (HCA029) recognizes intact Osteocalcin but not fragments corresponding to amino acids 7-19, 37-49 or 45-49.
    • Intended Use
    • Target Species
      Bovine
    • Species Cross-Reactivity
      Target SpeciesCross Reactivity
      Humanyes
      N.B. Antibody reactivity and working conditions may vary between species.
    • Product Form
      A bivalent human recombinant Fab selected from the HuCAL® GOLD phage display library. Expressed in E. coli and purified using NiNTA affinity chromatography. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a his-tag (HHHHHH) at the C-terminus of the anti-body heavy chain. - Lyophilised
    • Reconstitution
      Reconstitute with 50ul distilled water
      Care should be taken during reconstitution as the protein may appear as a film at the bottom of the vial. Bio-Rad recommend that the vial is gently mixed after reconstitution.
    • Preparation
      Purified antibody was prepared by Metal chelate affinity chromatography
    • Preservative Stabilisers
      None present
    • Immunogen
      Native bovine Osteocalcin with the sequence YLDHWLGAPAPYPDPLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV
    • Purity
    • Approx. Protein Concentrations
      Antibody concentration 1.0mg ml following re-constitution
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
    • Storage
      Prior to reconstitution store at +4oC.
      After reconstitution store at -20oC.
      Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
    • Shelf Life
      6 months from date of reconstitution.
    • Acknowledgements
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      ELISA2ug/ml
      Western Blotting5ug/ml

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • ELISA
    • Immunohistology
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Western Blotting
    • Instructions For Use

    Additional Osteocalcin Antibody Formats

    Formats Clone Applications Sizes available
    Osteocalcin Antibody : Purified 2591 E, WB 50 µg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Mouse anti c-Myc:HRPMCA2200P0.1 mgC, E, P, WB*
      MCA2200P
      Goat anti Human IgG F(ab')2:HRP0500-00990.5 mlE, WB
      0500-0099
      Mouse anti Penta Histidine Tag:HRPMCA5995P125 µlE, WB
      MCA5995P

      Recommended Negative Isotype Control

        Useful Reagents

          Recommended Positive Controls

            Histology Controls

              References

              Write your review

              You may also be interested in...