IL-2 Antibody | AbD22297

//www.bio-rad-antibodies.com/cow-bovine-il-2-antibody-abd22297-hca268.html
IL-2 Antibody | AbD22297 gallery image 1

Bovine Interleukin-2 ELISA

Recombinant bovine interleukin-2 detected using Human anti Bovine interleukin-2, clone AbD21766 (HCA267) as the capture antibody and Human anti Bovine interleukin-2 clone AbD22297 (HCA268) followed by Mouse anti Histidine Tag:HRP (MCA1396P) as the detection reagent

Enlarge
  • IL-2 Antibody | AbD22297 thumbnail image 1
  • Human anti Bovine Interleukin-2
  • Human anti Bovine Interleukin-2:HRP
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
    AbD22297
  • Isotype
    HuCAL Fab bivalent
2 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA268E, ESdatasheet pdfdatasheet pdf0.1 mg
    HCA268
    HCA268PE, ESdatasheet pdfdatasheet pdf0.1 mg
    HCA268P
    Summary
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    References
    Reviews
    -
    • Human anti Bovine Interleukin-2, clone AbD22297 recognizes bovine interleukin-2 (IL-2), also known as T-cell growth factor (TCGF). Bovine IL-2 is a 155 amino acid secreted cytokine produced by T-cells following antigenic or mitogenic stimulation. It plays a crucial role in T-cell proliferation and immune regulation.

      Human anti bovine interleukin-2, clone AbD22297, has been successfully used for the detection and measurement of native and recombinant bovine IL-2 in ELISA where it acts as the detection antibody in a sensitive assay for bovine IL-2 determination. Bio-Rad recommend clone AbD21766 (HCA267) for intracellular flow cytometry.
    • Intended Use
    • Target Species
      Bovine
    • Product Form
      A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
      A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). Conjugated to horseradish peroxidase (HRP) - liquid.
    • Reconstitution
    • Preparation
      Metal chelate affinity chromatography
      Metal chelate affinity chromatography
    • Preservative Stabilisers
      0.01% Thiomersal
      0.01% Thiomersal
    • Immunogen
      Fc-fusion protein containing the amino acid sequence 21-155 from bovine interleukin-2
    • Purity
    • Affinity
      The monovalent intrinsic affinity of this antibody was measured as KD=0.3 nM by real time, label-free molecular interaction analysis on recombinant bovine IL-2.
    • Approx. Protein Concentrations
      Antibody concentration 0.5 mg/ml
      Antibody concentration 0.1 mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
      Phosphate buffered saline.
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Store at -70oC.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody.
    • Shelf Life
      12 months from date of despatch
      12 months from date of despatch.
    • GO Terms
      immune response
      growth factor activity
      cytokine activity
      extracellular space
    • UniProt
    • Entrez Gene
    • Acknowledgements
      Sold under license of U.S. Patents 6,300,064, 6,696,248, 6,708,484, 6,753,136, European patent 0,859,841 and corresponding patents. This antibody was developed by Bio-Rad, a wholly owned subsidiary of Bio-Rad Laboratories Inc., Zeppelinstr. 4, 82178 Puchheim, Germany.
      Sold under license of U.S. Patents 6,300,064, 6,696,248, 6,708,484, 6,753,136, European patent 0,859,841 and corresponding patents. This antibody was developed by Bio-Rad, a wholly owned subsidiary of Bio-Rad Laboratories Inc., Zeppelinstr. 4, 82178 Puchheim, Germany.
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      ELISA
      ELISpot
      Flow Cytometry
    • Application NameYesNoMin DilutionMax Dilution
      ELISA
      ELISpot
      Flow Cytometry

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • Recommended Protocol
    • ELISA
      This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.
    • ELISA
      This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.
    • Immunohistology
    • Immunohistology
    • Histology Positive Control Tissue
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Immunofluorescence
    • Western Blotting
    • Western Blotting
    • Instructions For Use
    • Instructions For Use

    Additional IL-2 Antibody Formats

    Formats Clone Applications Sizes available
    IL-2 Antibody : HRP AbD22297 E, ES 0.1 mg
    IL-2 Antibody : Purified AbD22297 E, ES 0.1 mg
    • Copyright © 2016 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Mouse anti V5-Tag:HRPMCA1360P0.1 mgE, WB
      MCA1360P

      Recommended Negative Isotype Control

        Useful Reagents

          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Streptavidin:HRPSTAR5B1 mgC, E, P, WB
          STAR5B
          Human anti Bovine Interleukin-2HCA2670.1 mgE, ES, F
          HCA267
          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Human anti Bovine Interleukin-2:Alexa Fluor® 647HCA267A647100 Tests/1mlF
          HCA267A647
          Streptavidin:HRPSTAR5B1 mgC, E, P, WB
          STAR5B
          Human anti Bovine Interleukin-2HCA2670.1 mgE, ES, F
          HCA267
          Human anti Bovine Interleukin-2HCA2680.1 mgE, ES
          HCA268

          Recommended Positive Controls

            Histology Controls

              Further Reading

              Write your review

              You may also be interested in...

              You May Also Be Interested In...