IL-2 Antibody | AbD22297

IL-2 Antibody | AbD22297 gallery image 1

Bovine Interleukin-2 ELISA

Recombinant bovine interleukin-2 detected using Human anti Bovine interleukin-2, clone AbD21766 (HCA267) as the capture antibody and Human anti Bovine interleukin-2 clone AbD22297 (HCA268) followed by Mouse anti Histidine Tag:HRP (MCA1396P) as the detection reagent

  • IL-2 Antibody | AbD22297 thumbnail image 1
  • Human anti Bovine Interleukin-2
  • Human anti Bovine Interleukin-2:HRP
(Rated 0.0 out of 5 based on 0 customer reviews)
  • Product Type
    Monoclonal Antibody
  • Clone
  • Isotype
    HuCAL Fab bivalent
2 Formats Available
    Product CodeApplicationsDatasheetMSDSPack SizeList PriceQuantity
    HCA268E, ESdatasheet pdfdatasheet pdf0.1 mg
    HCA268PE, ESdatasheet pdfdatasheet pdf0.1 mg
    Secondary Antibodies
    Negative Isotype Controls
    Useful Reagents
    Positive Controls
    Histology Controls
    More Images
    • Human anti Bovine Interleukin-2, clone AbD22297 recognizes bovine interleukin-2 (IL-2), also known as T-cell growth factor (TCGF). Bovine IL-2 is a 155 amino acid secreted cytokine produced by T-cells following antigenic or mitogenic stimulation. It plays a crucial role in T-cell proliferation and immune regulation.

      Human anti bovine interleukin-2, clone AbD22297, has been successfully used for the detection and measurement of native and recombinant bovine IL-2 in ELISA where it acts as the detection antibody in a sensitive assay for bovine IL-2 determination. Bio-Rad recommend clone AbD21766 (HCA267) for intracellular flow cytometry.
    • Intended Use
    • Target Species
    • Product Form
      A bivalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
      A bivalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). Conjugated to horseradish peroxidase (HRP) - liquid.
    • Reconstitution
    • Preparation
      Metal chelate affinity chromatography
      Metal chelate affinity chromatography
    • Preservative Stabilisers
      0.01% Thiomersal
      0.01% Thiomersal
    • Immunogen
      Fc-fusion protein containing the amino acid sequence 21-155 from bovine interleukin-2
    • Purity
    • Affinity
      The monovalent intrinsic affinity of this antibody was measured as KD=0.3 nM by real time, label-free molecular interaction analysis on recombinant bovine IL-2.
    • Approx. Protein Concentrations
      Antibody concentration 0.5 mg/ml
      Antibody concentration 0.1 mg/ml
    • Reagents In The Kit
    • Preparing The Antibody
    • Test Principle
    • Buffer Solution
      Phosphate buffered saline
      Phosphate buffered saline.
    • Storage
      Store at +4oC or at -20oC if preferred.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
      Store at -70oC.
      Storage in frost-free freezers is not recommended.
      This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody.
    • Shelf Life
      12 months from date of despatch
      12 months from date of despatch.
    • GO Terms
      immune response
      growth factor activity
      cytokine activity
      extracellular space
    • UniProt
    • Entrez Gene
    • Acknowledgements
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
      Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
    • Licensed Use
      For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
    • Regulatory
      For research purposes only
    • This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.

    • Application NameYesNoMin DilutionMax Dilution
      Flow Cytometry
    • Application NameYesNoMin DilutionMax Dilution
      Flow Cytometry

    • Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Technical Advice
      Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
    • Recommended Protocol
    • Recommended Protocol
    • ELISA
      This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.
    • ELISA
      This product may be used as a detection reagent in a sandwich ELISA together with HCA267 as the capture reagent.
    • Immunohistology
    • Immunohistology
    • Histology Positive Control Tissue
    • Histology Positive Control Tissue
    • Immunofluorescence
    • Immunofluorescence
    • Western Blotting
    • Western Blotting
    • Instructions For Use
    • Instructions For Use

    Additional IL-2 Antibody Formats

    Formats Clone Applications Sizes available
    IL-2 Antibody : HRP AbD22297 E, ES 0.1 mg
    IL-2 Antibody : Purified AbD22297 E, ES 0.1 mg
    • Copyright © 2017 Bio-Rad Antibodies (formerly AbD Serotec)

    Recommended Secondary Antibody

      DescriptionProduct CodePack SizeApplicationsList PriceQuantity
      Mouse anti V5-Tag:HRPMCA1360P0.1 mgE, WB

      Recommended Negative Isotype Control

        Useful Reagents

          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Streptavidin:HRPSTAR5B1 mgC, E, P, WB
          Human anti Bovine Interleukin-2HCA2670.1 mgE, ES, F
          DescriptionProduct CodePack SizeApplicationsList PriceQuantity
          Human anti Bovine Interleukin-2:Alexa Fluor® 647HCA267A647100 Tests/1mlF
          Streptavidin:HRPSTAR5B1 mgC, E, P, WB
          Human anti Bovine Interleukin-2HCA2670.1 mgE, ES, F
          Human anti Bovine Interleukin-2HCA2680.1 mgE, ES

          Recommended Positive Controls

            Histology Controls

              Further Reading

              Write your review

              • View more products with "IL-2" specificity.
              No experiment is complete without all the pieces

              You may also be interested in...