HuCAL Fab-MSx2 Negative Control antibody | AbD08967
No associated image currently available
HuCAL Fab-MSx2 negative control, clone AbD08967 is a recombinant Fab antibody fragment in the format Fab-MSx2 with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It has been tested by ELISA for specificity to GFP, but has not been tested in other applications. It is suggested as a negative control reagent when using other HuCAL antibodies of the same Fab format.
It is recommended that this reagent is used at the same concentration as the test reagent.
It is recommended that this reagent is used at the same concentration as the test reagent.
Product Details
- Target Species
- Negative Control
- Product Form
- A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL® GOLD phage display library. Expressed in E. coli. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
- Preparation
- StrepTactin affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.01% Thiomersal
- Immunogen
- Green fluorescent protein.
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
Storage Information
- Storage
- Store at +4°C or at -20°C if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. - Guarantee
- 12 months from date of despatch
More Information
- Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
- Regulatory
- For research purposes only
Applications of HuCAL Fab-MSx2 Negative Control antibody
| Application Name | Verified | Min Dilution | Max Dilution |
|---|---|---|---|
| ELISA |
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Copyright © 2021 Bio-Rad Antibodies (formerly AbD Serotec)
Secondary Antibodies Available
| Description | Product Code | Applications | Pack Size | List Price | Quantity |
|---|---|---|---|---|---|
| Mouse anti c-Myc | MCA2200 | C E F* P WB* | 1 mg |
|
|
| Mouse anti c-Myc:Alk.Phos. | MCA2200A | C E P WB* | 0.1 mg |
|
|
| Mouse anti c-Myc:Alexa Fluor® 488 | MCA2200A488 | F* | 100 Tests/1ml |
|
|
| Mouse anti c-Myc:Alexa Fluor® 647 | MCA2200A647 | F* | 100 Tests/1ml |
|
|
| Mouse anti c-Myc:FITC | MCA2200F | F* | 0.1 mg |
|
|
| Mouse anti c-Myc:HRP | MCA2200P | C E P WB* | 0.1 mg |
|
|
| Mouse anti c-Myc:RPE | MCA2200PE | WB | 100 Tests |
|
|
| Mouse anti Strep-Tag Classic:HRP | MCA2489P | E WB | 75 µl |
|
Fluorescent Spectraviewer
Watch the Tool Tutorial Video ▸
How to Use the Spectraviewer?
Watch the Tool Tutorial Video ▸
- Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
- Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
- Select the lasers and filters you wish to include
- Select combined or multi-laser view to visualize the spectra
