HuCAL Fab-dHLX-FSx2 Negative Control antibody | AbD08970
No associated image currently available
HuCAL Fab-dHLX-FSx2 Negative Control:Alexa Fluor® 488
HuCAL Fab-dHLX-FSx2 Negative Control:Alexa Fluor® 647
HuCAL Fab-dHLX-FSx2 Negative Control
- Product Type
- Negative/Isotype Control
- Clone
- AbD08970
- Isotype
- HuCAL Fab bivalent
| Product Code | Applications | Datasheet | MSDS | Pack Size | List Price | Quantity |
|---|---|---|---|---|---|---|
| HCA104A488 | F | 100 Tests/1ml | ||||
| HCA104A647 | F | 100 Tests/1ml | ||||
| HCA104A | C E F P WB | 50 µg |
Human Fab-dHLX-FSx2 antibody, clone AbD08970 is a recombinant antibody with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It is therefore recommended as a negative control reagent when using other HuCAL antibodies of the same format.
It is recommended that this reagent is used at the same concentration as the test reagent.
It is recommended that this reagent is used at the same concentration as the test reagent.
Product Details
- Target Species
- Negative Control
- Product Form
- A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid and conjugated to Alexa Fluor®488.
- Product Form
- A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid and conjugated to Alexa Fluor®647.
- Product Form
- A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
- Preparation
- StrepTactin affinity chromatography
- Preparation
- StrepTactin affinity chromatography
- Preparation
- StrepTactin affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Buffer Solution
- Phosphate buffered saline
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
1% Bovine Serum Albumin - Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
1% Bovine Serum Albumin - Preservative Stabilisers
- 0.01% Thiomersal
- Immunogen
- Green fluorescent protein
- Approx. Protein Concentrations
- Antibody concentration 0.05 mg/ml
- Approx. Protein Concentrations
- Antibody concentration 0.05 mg/ml
- Approx. Protein Concentrations
- Total protein concentration 0.5 mg/ml
Storage Information
- Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. This product is photosensitive and should be protected from light.
Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. This product is photosensitive and should be protected from light.
Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Shelf Life
- 12 months from date of despatch
- Shelf Life
- 12 months from date of despatch
- Shelf Life
- 12 months from date of despatch
More Information
- Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents.
This product is provided under an intellectual property licence from Life Technologies Corporation. The transfer of this product is contingent on the buyer using the purchase product solely in research, excluding contract research or any fee for service research, and the buyer must not sell or otherwise transfer this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; (c) manufacturing or quality assurance or quality control, or (d) resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad CA 92008 USA or outlicensing@thermofisher.com - Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents.
This product is provided under an intellectual property licence from Life Technologies Corporation. The transfer of this product is contingent on the buyer using the purchase product solely in research, excluding contract research or any fee for service research, and the buyer must not sell or otherwise transfer this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; (c) manufacturing or quality assurance or quality control, or (d) resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad CA 92008 USA or outlicensing@thermofisher.com - Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
- Regulatory
- For research purposes only
Applications of HuCAL Fab-dHLX-FSx2 Negative Control antibody
| Application Name | Verified | Min Dilution | Max Dilution |
|---|---|---|---|
| Flow Cytometry | |||
| Flow Cytometry | |||
| ELISA | |||
| Flow Cytometry | |||
| Immunohistology - Frozen | |||
| Immunohistology - Paraffin | |||
| Western Blotting |
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Copyright © 2019 Bio-Rad Antibodies (formerly AbD Serotec)
Secondary Antibodies Available
| Description | Product Code | Pack Size | Applications | List Price | Quantity |
|---|---|---|---|---|---|
| Mouse anti Strep-Tag Classic:HRP | MCA2489P | 75 µl | E WB |
