HuCAL Fab-dHLX-FSx2 Negative Control antibody | AbD08970

HuCAL Fab-dHLX-FSx2 Negative Control:Alexa Fluor® 488
HuCAL Fab-dHLX-FSx2 Negative Control:Alexa Fluor® 647
HuCAL Fab-dHLX-FSx2 Negative Control
- Product Type
- Negative/Isotype Control
- Clone
- AbD08970
- Isotype
- HuCAL Fab bivalent
Product Code | Applications | Pack Size | List Price | Quantity |
---|---|---|---|---|
HCA104A488 | 100 Tests/1ml |
![]() |
||
HCA104A647 | 100 Tests/1ml |
![]() |
||
HCA104A | E | 50 µg |
![]() |
It is recommended that this reagent is used at the same concentration as the test reagent.
Product Details
- Target Species
- Negative Control
- Product Form
- A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid and conjugated to Alexa Fluor®488.
- Product Form
- A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid and conjugated to Alexa Fluor®647.
- Product Form
- A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
- Preparation
- StrepTactin affinity chromatography
- Preparation
- StrepTactin affinity chromatography
- Preparation
- StrepTactin affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Buffer Solution
- Phosphate buffered saline
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
1% Bovine Serum Albumin - Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
1% Bovine Serum Albumin - Preservative Stabilisers
- 0.01% Thiomersal
- Immunogen
- Green fluorescent protein
- Approx. Protein Concentrations
- Antibody concentration 0.05 mg/ml
- Approx. Protein Concentrations
- Antibody concentration 0.05 mg/ml
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
Storage Information
- Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. This product is photosensitive and should be protected from light.
Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. This product is photosensitive and should be protected from light.
Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Storage
- Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Guarantee
- 12 months from date of despatch
- Guarantee
- 12 months from date of despatch
- Guarantee
- 12 months from date of despatch
More Information
- Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents.
This product is provided under an intellectual property licence from Life Technologies Corporation. The transfer of this product is contingent on the buyer using the purchase product solely in research, excluding contract research or any fee for service research, and the buyer must not sell or otherwise transfer this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; (c) manufacturing or quality assurance or quality control, or (d) resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad CA 92008 USA or outlicensing@thermofisher.com - Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents.
This product is provided under an intellectual property licence from Life Technologies Corporation. The transfer of this product is contingent on the buyer using the purchase product solely in research, excluding contract research or any fee for service research, and the buyer must not sell or otherwise transfer this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; (c) manufacturing or quality assurance or quality control, or (d) resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad CA 92008 USA or outlicensing@thermofisher.com - Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
- Regulatory
- For research purposes only
Applications of HuCAL Fab-dHLX-FSx2 Negative Control antibody
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Secondary Antibodies Available
Description | Product Code | Applications | Pack Size | List Price | Quantity |
---|---|---|---|---|---|
Mouse anti Strep-Tag Classic:HRP | MCA2489P | E WB | 75 µl |
![]() |
Fluorescent Spectraviewer
Watch the Tool Tutorial Video ▸
How to Use the Spectraviewer?
Watch the Tool Tutorial Video ▸
- Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
- Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
- Select the lasers and filters you wish to include
- Select combined or multi-laser view to visualize the spectra