HuCAL Fab-dHLX-FSx2 Negative Control antibody | AbD08970

100% Secure

HuCAL Fab-dHLX-FSx2 Negative Control:Alexa Fluor® 647

HuCAL Fab-dHLX-FSx2 Negative Control

Product Type
Negative/Isotype Control
HuCAL Fab bivalent
Product Code Applications Pack Size List Price Quantity
100 Tests/1ml loader

50 µg loader

HuCAL Fab-dHLX-FSx2 negative control, clone AbD08970 is a recombinant Fab antibody fragment in the format Fab-dHLX-FSx2 with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It has been tested by ELISA for specificity to GFP, but has not been tested in other applications. It is suggested as a negative control reagent when using other HuCAL antibodies of the same Fab format.

It is recommended that this reagent is used at the same concentration as the test reagent.

Product Details

Target Species
Negative Control
Product Form
A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid and conjugated to Alexa Fluor®647.
Product Form
A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
StrepTactin affinity chromatography
StrepTactin affinity chromatography
Buffer Solution
Phosphate buffered saline
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
1% Bovine Serum Albumin
Preservative Stabilisers
0.01% Thiomersal
Green fluorescent protein
Approx. Protein Concentrations
Antibody concentration 0.05 mg/ml
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml

Storage Information

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
12 months from date of despatch
12 months from date of despatch

More Information

This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See for details.
This product is provided under an intellectual property licence from Life Technologies Corporation. The transfer of this product is contingent on the buyer using the purchase product solely in research, excluding contract research or any fee for service research, and the buyer must not sell or otherwise transfer this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; (c) manufacturing or quality assurance or quality control, or (d) resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad CA 92008 USA or
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See for details.
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
For research purposes only

Applications of HuCAL Fab-dHLX-FSx2 Negative Control antibody

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual

Secondary Antibodies Available

Description Product Code Applications Pack Size List Price Quantity
Mouse anti Strep-Tag Classic:HRP MCA2489P E WB 75 µl loader

Fluorescent Spectraviewer

Watch the Tool Tutorial Video ▸

How to Use the Spectraviewer

Watch the Tool Tutorial Video ▸
  • Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
  • Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
  • Select the lasers and filters you wish to include
  • Select combined or multi-laser view to visualize the spectra