HuCAL Fab-A-V5Sx2 Negative Control antibody | AbD11074

No associated image currently available
HuCAL Fab-A-V5Sx2 negative control, clone AbD11074 is a recombinant antibody with specificity for green fluorescent protein (GFP). It has no known reactivity with mammalian proteins or other antigens. It is therefore recommended as a negative control reagent when using other HuCAL antibodies of the same format. It is recommended that this reagent is used at the same concentration as the test reagent.
Product Details
- Target Species
- Negative Control
- Product Form
- A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied lyophilized.
- Reconstitution
- Reconstitute with 1.0 ml distilled water
- Preparation
- StrepTactin affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
1% Bovine Serum Albumin - Immunogen
- Green fluorescent protein.
- Approx. Protein Concentrations
- Ig concentration 0.1 mg/ml after reconstitution
Storage Information
- Storage
- Prior to reconstitution store at +4oC.
After reconstitution store at -20oC.
Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. - Shelf Life
- 12 months from date of reconstitution
More Information
- Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
- Regulatory
- For research purposes only
Applications of HuCAL Fab-A-V5Sx2 Negative Control antibody
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA | |||
Flow Cytometry | |||
Immunohistology - Frozen | |||
Immunohistology - Paraffin | |||
Western Blotting |
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Copyright © 2019 Bio-Rad Antibodies (formerly AbD Serotec)
Secondary Antibodies Available
Description | Product Code | Pack Size | Applications | List Price | Quantity |
---|---|---|---|---|---|
Mouse anti Strep-Tag Classic:HRP | MCA2489P | 75 µl | E WB | ||
Rat anti DYKDDDDK Tag | MCA4764 | 0.2 mg | E F IF IP P WB | ||
Rat anti DYKDDDDK Tag:Alexa Fluor®647 | MCA4764A647 | 1 ml | F | ||
Rat anti DYKDDDDK Tag:FITC | MCA4764F | 0.1 mg | F IF | ||
Rat anti DYKDDDDK Tag:HRP | MCA4764P | 0.1 mg | E P WB | ||
Rat anti DYKDDDDK Tag:RPE | MCA4764PE | 100 Tests | F |