HuCAL Fab-A-MSx2 Negative Control antibody | AbD08971

It is recommended that this reagent is used at the same concentration as the test reagent.
Product Details
- Target Species
- Negative Control
- Product Form
- A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL® GOLD phage display library. Expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
- Preparation
- StrepTactin affinity chromatography
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.01% Thiomersal
- Immunogen
- Green fluorescent protein
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
Storage Information
- Storage
- Store at +4°C or at -20°C if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. - Guarantee
- 12 months from date of despatch
More Information
- Acknowledgements
- Sold under license of U.S. Patents 6753136, 7785859 and 8273688 and corresponding patents. This antibody was developed by Bio-Rad, Zeppelinstr. 4, 82178 Puchheim, Germany.
- Licensed Use
- For in vitro research purposes only, unless otherwise specified in writing by Bio-Rad.
- Regulatory
- For research purposes only
Applications of HuCAL Fab-A-MSx2 Negative Control antibody
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual
Secondary Antibodies Available
Description | Product Code | Applications | Pack Size | List Price | Quantity |
---|---|---|---|---|---|
Mouse anti c-Myc:Alk.Phos. | MCA2200A | C E P WB* | 0.1 mg |
![]() |
|
Mouse anti c-Myc:Alexa Fluor® 488 | MCA2200A488 | F* | 100 Tests/1ml |
![]() |
|
Mouse anti c-Myc:Alexa Fluor® 647 | MCA2200A647 | F* | 100 Tests/1ml |
![]() |
|
Mouse anti c-Myc:Biotin | MCA2200B | C E P WB* | 0.1 mg |
![]() |
|
Mouse anti c-Myc:FITC | MCA2200F | F* | 0.1 mg |
![]() |
|
Mouse anti c-Myc:HRP | MCA2200P | C E P WB* | 0.1 mg |
![]() |
|
Mouse anti c-Myc:RPE | MCA2200PE | WB | 100 Tests |
![]() |
|
Mouse anti Strep-Tag Classic:HRP | MCA2489P | E WB | 75 µl |
![]() |
Fluorescent Spectraviewer
Watch the Tool Tutorial Video ▸
How to Use the Spectraviewer?
Watch the Tool Tutorial Video ▸
- Start by selecting the application you are interested in, with the option to select an instrument from the drop down menu or create a customized instrument
- Select the fluorophores or fluorescent proteins you want to include in your panel to check compatibility
- Select the lasers and filters you wish to include
- Select combined or multi-laser view to visualize the spectra